BLASTX nr result
ID: Bupleurum21_contig00026937
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00026937 (537 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533404.1| conserved hypothetical protein [Ricinus comm... 79 3e-13 ref|XP_002328327.1| predicted protein [Populus trichocarpa] gi|2... 73 2e-11 ref|XP_003602561.1| Protein IDA-like protein [Medicago truncatul... 70 3e-10 ref|XP_003630198.1| Protein IDA-like protein [Medicago truncatul... 69 3e-10 gb|AFK45340.1| unknown [Medicago truncatula] 67 2e-09 >ref|XP_002533404.1| conserved hypothetical protein [Ricinus communis] gi|223526749|gb|EEF28977.1| conserved hypothetical protein [Ricinus communis] Length = 87 Score = 79.3 bits (194), Expect = 3e-13 Identities = 41/73 (56%), Positives = 51/73 (69%), Gaps = 7/73 (9%) Frame = +2 Query: 287 LLFLLHVWMIMVTSVE------GSRTNINVFNPKPK-PNSGHFLNNMPRRMPIPFSGPSR 445 L+FLL W++++ + GSRT NVF+ KPK + GHFLN +PR PIP SGPSR Sbjct: 16 LVFLLF-WILLLLFISFFGYCHGSRTTANVFDVKPKNQHRGHFLNFLPRHFPIPTSGPSR 74 Query: 446 KHNDIGLQSWNSP 484 +HNDIGLQSW SP Sbjct: 75 RHNDIGLQSWRSP 87 >ref|XP_002328327.1| predicted protein [Populus trichocarpa] gi|222838042|gb|EEE76407.1| predicted protein [Populus trichocarpa] Length = 78 Score = 73.2 bits (178), Expect = 2e-11 Identities = 36/69 (52%), Positives = 44/69 (63%), Gaps = 1/69 (1%) Frame = +2 Query: 281 SLLLFLLHVWMIMVTSVEGSRTNINVFNPKPKPN-SGHFLNNMPRRMPIPFSGPSRKHND 457 +LLL L ++ I + NVFN KPK GHFLN +PR +PIP SGPSR+HN Sbjct: 10 TLLLCLFFLFFIFFVGYSHGSRSTNVFNFKPKTQYKGHFLNFLPRHLPIPTSGPSRRHNG 69 Query: 458 IGLQSWNSP 484 IGLQ+W SP Sbjct: 70 IGLQNWRSP 78 >ref|XP_003602561.1| Protein IDA-like protein [Medicago truncatula] gi|355491609|gb|AES72812.1| Protein IDA-like protein [Medicago truncatula] Length = 76 Score = 69.7 bits (169), Expect = 3e-10 Identities = 39/70 (55%), Positives = 48/70 (68%), Gaps = 1/70 (1%) Frame = +2 Query: 278 SSLLLFLLHVWMIMVTSVEGSRTNINVFNPKPK-PNSGHFLNNMPRRMPIPFSGPSRKHN 454 +SLLL LL ++ + +GSR NVF KPK + GHF +PRR+PIP+S PSRKHN Sbjct: 10 TSLLLLLL--FLCIFGHCDGSRAT-NVFKVKPKYEHKGHFFGFLPRRIPIPYSSPSRKHN 66 Query: 455 DIGLQSWNSP 484 DIGLQS SP Sbjct: 67 DIGLQSLRSP 76 >ref|XP_003630198.1| Protein IDA-like protein [Medicago truncatula] gi|357519903|ref|XP_003630240.1| Protein IDA-like protein [Medicago truncatula] gi|355524220|gb|AET04674.1| Protein IDA-like protein [Medicago truncatula] gi|355524262|gb|AET04716.1| Protein IDA-like protein [Medicago truncatula] Length = 76 Score = 69.3 bits (168), Expect = 3e-10 Identities = 36/70 (51%), Positives = 47/70 (67%), Gaps = 5/70 (7%) Frame = +2 Query: 290 LFLLHVWMIMVTSV----EGSRTNINVFNPKPKP-NSGHFLNNMPRRMPIPFSGPSRKHN 454 L LL +W++++ + GSRT N F KPK + GHF +P+RM IP+S PSRKHN Sbjct: 8 LQLLVIWLLLILFILGQCHGSRTT-NDFKVKPKSEHQGHFFGFLPKRMHIPYSTPSRKHN 66 Query: 455 DIGLQSWNSP 484 DIGL+SW SP Sbjct: 67 DIGLRSWRSP 76 >gb|AFK45340.1| unknown [Medicago truncatula] Length = 76 Score = 67.0 bits (162), Expect = 2e-09 Identities = 38/70 (54%), Positives = 47/70 (67%), Gaps = 1/70 (1%) Frame = +2 Query: 278 SSLLLFLLHVWMIMVTSVEGSRTNINVFNPKPK-PNSGHFLNNMPRRMPIPFSGPSRKHN 454 +SLLL LL ++ + +GSR NVF KPK + GHF +P R+PIP+S PSRKHN Sbjct: 10 TSLLLLLL--FLCIFGHCDGSRAT-NVFKVKPKYEHKGHFFGFLPGRIPIPYSSPSRKHN 66 Query: 455 DIGLQSWNSP 484 DIGLQS SP Sbjct: 67 DIGLQSLRSP 76