BLASTX nr result
ID: Bupleurum21_contig00026835
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00026835 (595 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515929.1| conserved hypothetical protein [Ricinus comm... 65 9e-09 ref|XP_002515928.1| conserved hypothetical protein [Ricinus comm... 58 1e-06 >ref|XP_002515929.1| conserved hypothetical protein [Ricinus communis] gi|223544834|gb|EEF46349.1| conserved hypothetical protein [Ricinus communis] Length = 75 Score = 65.1 bits (157), Expect = 9e-09 Identities = 31/63 (49%), Positives = 36/63 (57%) Frame = +2 Query: 20 MANLNPKSXXXXXXXXXXXXSPALPCEAARLPHREILQDDGPVCLACECCAPPPSPDKCC 199 MA + KS SP +P EAARL HR++LQ P+C AC CCAPPP P CC Sbjct: 1 MATNSLKSSFVTFLVFAMILSPIIPSEAARLNHRDLLQTRPPICPACVCCAPPP-PGSCC 59 Query: 200 ICC 208 CC Sbjct: 60 RCC 62 >ref|XP_002515928.1| conserved hypothetical protein [Ricinus communis] gi|223544833|gb|EEF46348.1| conserved hypothetical protein [Ricinus communis] Length = 73 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/64 (43%), Positives = 38/64 (59%), Gaps = 1/64 (1%) Frame = +2 Query: 20 MANLNPKSXXXXXXXXXXXXSPALPCEAARLPHREILQDDGPV-CLACECCAPPPSPDKC 196 MA+ + KS SP +P EAAR+ R++LQ + P+ C AC CC+PPP P +C Sbjct: 1 MASSSLKSFLVTLFIFAMVLSPMIPSEAARMNQRDLLQTNEPIFCPACVCCSPPP-PGQC 59 Query: 197 CICC 208 C CC Sbjct: 60 CDCC 63