BLASTX nr result
ID: Bupleurum21_contig00026822
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00026822 (332 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002460138.1| hypothetical protein SORBIDRAFT_02g023240 [S... 62 6e-08 >ref|XP_002460138.1| hypothetical protein SORBIDRAFT_02g023240 [Sorghum bicolor] gi|241923515|gb|EER96659.1| hypothetical protein SORBIDRAFT_02g023240 [Sorghum bicolor] Length = 338 Score = 61.6 bits (148), Expect = 6e-08 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = -1 Query: 203 KVVTTTVNDEEFWDEFDSILAIARPIYRMIKFADGEGQKMGEI 75 K + T+NDE FW+E D+ILA PIY +++F+DGEG KMGEI Sbjct: 265 KAIVDTINDENFWNEVDNILAFIEPIYSVLRFSDGEGPKMGEI 307