BLASTX nr result
ID: Bupleurum21_contig00026769
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00026769 (532 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002305987.1| predicted protein [Populus trichocarpa] gi|2... 87 2e-15 ref|XP_002278099.2| PREDICTED: protease Do-like 8, chloroplastic... 86 4e-15 gb|AFK34777.1| unknown [Lotus japonicus] 85 6e-15 ref|XP_002524371.1| Protease degQ precursor, putative [Ricinus c... 83 3e-14 ref|XP_004166387.1| PREDICTED: protease Do-like 8, chloroplastic... 81 8e-14 >ref|XP_002305987.1| predicted protein [Populus trichocarpa] gi|222848951|gb|EEE86498.1| predicted protein [Populus trichocarpa] Length = 435 Score = 86.7 bits (213), Expect = 2e-15 Identities = 47/72 (65%), Positives = 47/72 (65%) Frame = +3 Query: 315 TRRTLLTXXXXXXXXXXXXXXXXXXXLGDPSVTIEQVTPPVFPSGTLFPPEERIVQLFEK 494 TRR LL LGDPSVTIEQVTPPV SG LFP EERIVQLFEK Sbjct: 54 TRRMLLASFFLFLGYHPPSRYLSAQALGDPSVTIEQVTPPVLTSGALFPVEERIVQLFEK 113 Query: 495 NTYSVVNIFDVT 530 NTYSVVNIFDVT Sbjct: 114 NTYSVVNIFDVT 125 >ref|XP_002278099.2| PREDICTED: protease Do-like 8, chloroplastic-like [Vitis vinifera] gi|296082900|emb|CBI22201.3| unnamed protein product [Vitis vinifera] Length = 449 Score = 85.5 bits (210), Expect = 4e-15 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = +3 Query: 393 LGDPSVTIEQVTPPVFPSGTLFPPEERIVQLFEKNTYSVVNIFDVT 530 LGDPSVTIE+VTPPV PSG LFP EERIVQLFE+NTYSVVNIFDVT Sbjct: 93 LGDPSVTIEEVTPPVSPSGPLFPTEERIVQLFERNTYSVVNIFDVT 138 >gb|AFK34777.1| unknown [Lotus japonicus] Length = 460 Score = 85.1 bits (209), Expect = 6e-15 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = +3 Query: 393 LGDPSVTIEQVTPPVFPSGTLFPPEERIVQLFEKNTYSVVNIFDVT 530 LGDPSVT+EQV PPVFPSG LFP E+R+VQLFE+NTYSVVNIFDVT Sbjct: 104 LGDPSVTLEQVIPPVFPSGPLFPAEDRVVQLFERNTYSVVNIFDVT 149 >ref|XP_002524371.1| Protease degQ precursor, putative [Ricinus communis] gi|223536332|gb|EEF37982.1| Protease degQ precursor, putative [Ricinus communis] Length = 453 Score = 82.8 bits (203), Expect = 3e-14 Identities = 40/46 (86%), Positives = 42/46 (91%) Frame = +3 Query: 393 LGDPSVTIEQVTPPVFPSGTLFPPEERIVQLFEKNTYSVVNIFDVT 530 LGDPSVT+E+VTPPV SG LFP EERIVQLFEKNTYSVVNIFDVT Sbjct: 97 LGDPSVTVEEVTPPVSLSGALFPTEERIVQLFEKNTYSVVNIFDVT 142 >ref|XP_004166387.1| PREDICTED: protease Do-like 8, chloroplastic-like [Cucumis sativus] Length = 429 Score = 81.3 bits (199), Expect = 8e-14 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = +3 Query: 393 LGDPSVTIEQVTPPVFPSGTLFPPEERIVQLFEKNTYSVVNIFDVT 530 LGDPSVTI++VTP + PSG+LFP EERI QLFEKNTYSVVNIFDVT Sbjct: 106 LGDPSVTIDEVTPTISPSGSLFPTEERIAQLFEKNTYSVVNIFDVT 151