BLASTX nr result
ID: Bupleurum21_contig00026748
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00026748 (481 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACY01928.1| hypothetical protein [Beta vulgaris] 37 6e-06 >gb|ACY01928.1| hypothetical protein [Beta vulgaris] Length = 1583 Score = 36.6 bits (83), Expect(3) = 6e-06 Identities = 15/27 (55%), Positives = 21/27 (77%) Frame = +3 Query: 129 PFEVIQYVGPVAYILQLPPTSKIHPLF 209 PF V++ +G VAY LQLP +K+HP+F Sbjct: 1417 PFSVLKRIGQVAYQLQLPLGAKLHPVF 1443 Score = 29.3 bits (64), Expect(3) = 6e-06 Identities = 15/51 (29%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +1 Query: 199 IHCFNHLSQCEKAIGESPAASQSPKLFVN-LALKVEPAAVLGIKNGKSVPS 348 +H H+SQ +KA+G ++ P N L L +P ++L I++ P+ Sbjct: 1439 LHPVFHISQLKKAVGSLQSSPTIPPQLTNDLVLDAQPESLLNIRSHPQKPA 1489 Score = 27.7 bits (60), Expect(3) = 6e-06 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 5/41 (12%) Frame = +2 Query: 344 PASEATGEDY-----HTPHFHLADKMAFGSGMMLQVTTRVV 451 PA EAT ED P FHL DK+ G + + TR++ Sbjct: 1502 PAFEATWEDAALFNARFPDFHLEDKVLNWEGSIAKSPTRII 1542