BLASTX nr result
ID: Bupleurum21_contig00026652
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00026652 (523 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002322233.1| predicted protein [Populus trichocarpa] gi|2... 61 7e-15 ref|XP_002311725.1| predicted protein [Populus trichocarpa] gi|2... 57 7e-14 ref|XP_002318706.1| predicted protein [Populus trichocarpa] gi|2... 59 7e-14 ref|XP_002511223.1| conserved hypothetical protein [Ricinus comm... 60 1e-13 ref|XP_002266342.1| PREDICTED: uncharacterized protein LOC100240... 57 6e-13 >ref|XP_002322233.1| predicted protein [Populus trichocarpa] gi|222869229|gb|EEF06360.1| predicted protein [Populus trichocarpa] Length = 436 Score = 60.8 bits (146), Expect(2) = 7e-15 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +3 Query: 111 SNTGGFTIYGWIVDRHLINTLFFTEMSLAFFVLGKTINI 227 SN GGFT++GW VDR LINT+FF E+SL FVLGKT+ + Sbjct: 395 SNPGGFTVFGWRVDRTLINTIFFLEISLVLFVLGKTVTL 433 Score = 44.3 bits (103), Expect(2) = 7e-15 Identities = 20/37 (54%), Positives = 28/37 (75%), Gaps = 1/37 (2%) Frame = +2 Query: 11 DYPESDLDSTDYVPLPTNMHLTSHV-SYQRRQSFVQH 118 +Y ESDL++ DYVP+PT L S++ SY +RQSFV + Sbjct: 356 NYSESDLEAVDYVPVPTTTQLASYMSSYHKRQSFVMY 392 >ref|XP_002311725.1| predicted protein [Populus trichocarpa] gi|222851545|gb|EEE89092.1| predicted protein [Populus trichocarpa] Length = 460 Score = 57.4 bits (137), Expect(2) = 7e-14 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +3 Query: 111 SNTGGFTIYGWIVDRHLINTLFFTEMSLAFFVLGKTI 221 +N GG TI+GW VDR LINT+FF E+SL FVLGKTI Sbjct: 420 NNPGGITIFGWTVDRGLINTIFFIELSLITFVLGKTI 456 Score = 44.3 bits (103), Expect(2) = 7e-14 Identities = 20/35 (57%), Positives = 28/35 (80%), Gaps = 1/35 (2%) Frame = +2 Query: 11 DYPESDLDSTDYVPLPTNMHLTSHV-SYQRRQSFV 112 +Y ESDL+S DY+ +PTNM L S++ SY +RQ+FV Sbjct: 381 NYSESDLESFDYIAMPTNMQLASYMTSYHKRQAFV 415 >ref|XP_002318706.1| predicted protein [Populus trichocarpa] gi|222859379|gb|EEE96926.1| predicted protein [Populus trichocarpa] Length = 437 Score = 58.9 bits (141), Expect(2) = 7e-14 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = +3 Query: 111 SNTGGFTIYGWIVDRHLINTLFFTEMSLAFFVLGKTINI 227 SN GGF+++GW +DR LI T+FF EMSL FVLGKTI I Sbjct: 396 SNPGGFSVFGWTIDRTLIITIFFLEMSLVLFVLGKTITI 434 Score = 42.7 bits (99), Expect(2) = 7e-14 Identities = 19/37 (51%), Positives = 28/37 (75%), Gaps = 1/37 (2%) Frame = +2 Query: 11 DYPESDLDSTDYVPLPTNMHLTSHVS-YQRRQSFVQH 118 +Y ESDL++ DYVP+PT L S++S Y +RQ+FV + Sbjct: 357 NYSESDLEAVDYVPVPTTTQLASYMSTYHKRQAFVTY 393 >ref|XP_002511223.1| conserved hypothetical protein [Ricinus communis] gi|223550338|gb|EEF51825.1| conserved hypothetical protein [Ricinus communis] Length = 433 Score = 60.1 bits (144), Expect(2) = 1e-13 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = +3 Query: 111 SNTGGFTIYGWIVDRHLINTLFFTEMSLAFFVLGKTINIT 230 SN GGF+I+GW++DR LINT+FF E+S FVLGKT+ T Sbjct: 392 SNPGGFSIFGWMIDRTLINTIFFLEISFVMFVLGKTLTFT 431 Score = 41.2 bits (95), Expect(2) = 1e-13 Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 1/37 (2%) Frame = +2 Query: 11 DYPESDLDSTDYVPLPTNMHLTSHV-SYQRRQSFVQH 118 +Y + DL+S DYVP+PTN LTS +Y RQ+FV + Sbjct: 353 NYSQCDLESVDYVPVPTNSQLTSSTQAYDMRQAFVAY 389 >ref|XP_002266342.1| PREDICTED: uncharacterized protein LOC100240965 [Vitis vinifera] gi|297738355|emb|CBI27556.3| unnamed protein product [Vitis vinifera] Length = 443 Score = 57.4 bits (137), Expect(2) = 6e-13 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +3 Query: 111 SNTGGFTIYGWIVDRHLINTLFFTEMSLAFFVLGKTI 221 +N GG TI+GW VDR LINT+FF E+SL FVLGKTI Sbjct: 402 NNPGGITIFGWTVDRALINTIFFIELSLITFVLGKTI 438 Score = 41.2 bits (95), Expect(2) = 6e-13 Identities = 19/37 (51%), Positives = 28/37 (75%), Gaps = 1/37 (2%) Frame = +2 Query: 11 DYPESDLDSTDYVPLPTNMHLTSHV-SYQRRQSFVQH 118 +Y ESDL+S DYV +PT+ L S++ SY +RQ+FV + Sbjct: 363 NYSESDLESLDYVVMPTSAQLASYMSSYHKRQAFVMY 399