BLASTX nr result
ID: Bupleurum21_contig00026642
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00026642 (363 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515332.1| conserved hypothetical protein [Ricinus comm... 65 7e-09 >ref|XP_002515332.1| conserved hypothetical protein [Ricinus communis] gi|223545812|gb|EEF47316.1| conserved hypothetical protein [Ricinus communis] Length = 171 Score = 64.7 bits (156), Expect = 7e-09 Identities = 27/46 (58%), Positives = 38/46 (82%) Frame = +1 Query: 226 KVEFPKLDGSNARTWIQKCERYFVLCKIPAEQQVEMASLHVTGKAK 363 K++FPK DGSN R WI+KC +YFV CKIP +Q+V++ASL++ KA+ Sbjct: 34 KLKFPKFDGSNLRQWIKKCCKYFVFCKIPDKQKVDLASLNMVDKAE 79