BLASTX nr result
ID: Bupleurum21_contig00026638
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00026638 (516 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003564451.1| PREDICTED: probable glucuronosyltransferase ... 62 4e-08 dbj|BAK07654.1| predicted protein [Hordeum vulgare subsp. vulgare] 62 4e-08 ref|XP_002520033.1| catalytic, putative [Ricinus communis] gi|22... 62 5e-08 ref|XP_003607437.1| Cation proton exchanger [Medicago truncatula... 62 6e-08 ref|XP_003607428.1| Exostosin family protein-like protein [Medic... 62 6e-08 >ref|XP_003564451.1| PREDICTED: probable glucuronosyltransferase GUT1-like [Brachypodium distachyon] Length = 495 Score = 62.4 bits (150), Expect = 4e-08 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -1 Query: 516 DMRMNLAKYSRHFLYSHPAQPLGPEDLAWRMVCSHLI 406 +M+ NL KYSRHF+YS PAQPLGPEDL WRMV L+ Sbjct: 426 EMQSNLVKYSRHFIYSKPAQPLGPEDLTWRMVAGKLV 462 >dbj|BAK07654.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 496 Score = 62.4 bits (150), Expect = 4e-08 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -1 Query: 516 DMRMNLAKYSRHFLYSHPAQPLGPEDLAWRMVCSHLI 406 +M+ NL KYSRHFLYS PAQPLGPEDL WRM+ L+ Sbjct: 427 EMQSNLLKYSRHFLYSSPAQPLGPEDLTWRMIAGKLV 463 >ref|XP_002520033.1| catalytic, putative [Ricinus communis] gi|223540797|gb|EEF42357.1| catalytic, putative [Ricinus communis] Length = 507 Score = 62.0 bits (149), Expect = 5e-08 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -1 Query: 516 DMRMNLAKYSRHFLYSHPAQPLGPEDLAWRMVCSHLI 406 +M+ NL KYSRHFLYS PAQPLGPEDL WRM+ L+ Sbjct: 436 EMQRNLVKYSRHFLYSSPAQPLGPEDLVWRMMAGKLV 472 >ref|XP_003607437.1| Cation proton exchanger [Medicago truncatula] gi|355508492|gb|AES89634.1| Cation proton exchanger [Medicago truncatula] Length = 1198 Score = 61.6 bits (148), Expect = 6e-08 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -1 Query: 516 DMRMNLAKYSRHFLYSHPAQPLGPEDLAWRMVCSHLI 406 +M+ NLAKYSRHFLYS PAQPLGPEDL W+M+ ++ Sbjct: 429 EMQQNLAKYSRHFLYSSPAQPLGPEDLVWKMMAGKVV 465 >ref|XP_003607428.1| Exostosin family protein-like protein [Medicago truncatula] gi|355508483|gb|AES89625.1| Exostosin family protein-like protein [Medicago truncatula] Length = 502 Score = 61.6 bits (148), Expect = 6e-08 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -1 Query: 516 DMRMNLAKYSRHFLYSHPAQPLGPEDLAWRMVCSHLI 406 +M+ NLAKYSRHFLYS PAQPLGPEDL W+M+ ++ Sbjct: 429 EMQQNLAKYSRHFLYSSPAQPLGPEDLVWKMMAGKVV 465