BLASTX nr result
ID: Bupleurum21_contig00026632
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00026632 (324 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003532360.1| PREDICTED: auxilin-related protein 2-like [G... 64 1e-08 ref|XP_003525134.1| PREDICTED: auxilin-related protein 2-like [G... 64 1e-08 ref|XP_003630318.1| Auxilin-like protein [Medicago truncatula] g... 63 3e-08 ref|XP_003630317.1| Auxilin-like protein [Medicago truncatula] g... 63 3e-08 ref|XP_003526879.1| PREDICTED: auxilin-related protein 2-like [G... 58 7e-07 >ref|XP_003532360.1| PREDICTED: auxilin-related protein 2-like [Glycine max] Length = 935 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/44 (65%), Positives = 40/44 (90%) Frame = -1 Query: 324 KDAMDHAEAKFRHAKELIDREHAKAARSKESVQLEKDEQEIPDD 193 K+AMD AEAKFRHAKE+ +RE++KAARSKE+VQ+EKDE+ + ++ Sbjct: 506 KEAMDRAEAKFRHAKEVREREYSKAARSKEAVQMEKDERTVLEE 549 >ref|XP_003525134.1| PREDICTED: auxilin-related protein 2-like [Glycine max] Length = 985 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/44 (65%), Positives = 40/44 (90%) Frame = -1 Query: 324 KDAMDHAEAKFRHAKELIDREHAKAARSKESVQLEKDEQEIPDD 193 K+AMD AEAKFRHAKE+ +RE++KAARSKE+VQ+EKDE+ + ++ Sbjct: 555 KEAMDRAEAKFRHAKEVREREYSKAARSKEAVQMEKDERTVLEE 598 >ref|XP_003630318.1| Auxilin-like protein [Medicago truncatula] gi|355524340|gb|AET04794.1| Auxilin-like protein [Medicago truncatula] Length = 949 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = -1 Query: 324 KDAMDHAEAKFRHAKELIDREHAKAARSKESVQLEKDEQEIPDD 193 K+AMD AEAKFRHAKE+ +REH KAA+SKE Q EKD++ IP++ Sbjct: 609 KEAMDRAEAKFRHAKEVREREHTKAAKSKEFGQSEKDDRAIPEE 652 >ref|XP_003630317.1| Auxilin-like protein [Medicago truncatula] gi|355524339|gb|AET04793.1| Auxilin-like protein [Medicago truncatula] Length = 1017 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = -1 Query: 324 KDAMDHAEAKFRHAKELIDREHAKAARSKESVQLEKDEQEIPDD 193 K+AMD AEAKFRHAKE+ +REH KAA+SKE Q EKD++ IP++ Sbjct: 609 KEAMDRAEAKFRHAKEVREREHTKAAKSKEFGQSEKDDRAIPEE 652 >ref|XP_003526879.1| PREDICTED: auxilin-related protein 2-like [Glycine max] Length = 922 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = -1 Query: 324 KDAMDHAEAKFRHAKELIDREHAKAARSKESVQLEKDEQEIPDD 193 K+AMD AEAKFRHAK + +RE+ KA++SKE VQLEKD + + +D Sbjct: 483 KEAMDRAEAKFRHAKGVRERENTKASKSKEPVQLEKDGRAVSED 526