BLASTX nr result
ID: Bupleurum21_contig00026239
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00026239 (332 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN75605.1| hypothetical protein VITISV_011223 [Vitis vinifera] 56 3e-06 emb|CAN61624.1| hypothetical protein VITISV_024716 [Vitis vinifera] 56 3e-06 ref|XP_002270813.1| PREDICTED: probable sucrose-phosphate syntha... 55 6e-06 emb|CBI17025.3| unnamed protein product [Vitis vinifera] 55 6e-06 >emb|CAN75605.1| hypothetical protein VITISV_011223 [Vitis vinifera] Length = 305 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/43 (62%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = +2 Query: 17 MLRSEDGYKREDLVPKDSPSIVF-AEGYEAQDISTALETFGIK 142 +L SED +KRED++P+DSPSI+F EGYEA+DI AL GIK Sbjct: 263 ILCSEDNFKREDMIPQDSPSIIFIEEGYEAEDICAALLALGIK 305 >emb|CAN61624.1| hypothetical protein VITISV_024716 [Vitis vinifera] Length = 166 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/43 (62%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = +2 Query: 17 MLRSEDGYKREDLVPKDSPSIVF-AEGYEAQDISTALETFGIK 142 +L SED +KRED++P+DSPSI+F EGYEA+DI AL GIK Sbjct: 124 ILCSEDSFKREDMIPQDSPSIIFIEEGYEAEDICAALLVLGIK 166 >ref|XP_002270813.1| PREDICTED: probable sucrose-phosphate synthase 4 [Vitis vinifera] gi|58825798|gb|AAW82754.1| sucrose-phosphate synthase 1 [Vitis vinifera] Length = 1043 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = +2 Query: 17 MLRSEDGYKREDLVPKDSPSIVFA-EGYEAQDISTALETFGIK 142 +LR+E+ +KRED++P+DSP+I F EGYEA +IS AL T GIK Sbjct: 1001 LLRNEESFKREDMIPQDSPNIAFVEEGYEALNISAALLTLGIK 1043 >emb|CBI17025.3| unnamed protein product [Vitis vinifera] Length = 1018 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = +2 Query: 17 MLRSEDGYKREDLVPKDSPSIVFA-EGYEAQDISTALETFGIK 142 +LR+E+ +KRED++P+DSP+I F EGYEA +IS AL T GIK Sbjct: 976 LLRNEESFKREDMIPQDSPNIAFVEEGYEALNISAALLTLGIK 1018