BLASTX nr result
ID: Bupleurum21_contig00026142
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00026142 (627 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264271.1| PREDICTED: uncharacterized protein LOC100256... 79 9e-13 gb|ADR71238.1| 30S ribosomal protein S6B [Hevea brasiliensis] 76 4e-12 gb|ADR71237.1| 30S ribosomal protein S6A [Hevea brasiliensis] 76 6e-12 ref|XP_002523537.1| structural constituent of ribosome, putative... 75 8e-12 ref|XP_002325157.1| predicted protein [Populus trichocarpa] gi|2... 74 2e-11 >ref|XP_002264271.1| PREDICTED: uncharacterized protein LOC100256785 [Vitis vinifera] Length = 162 Score = 78.6 bits (192), Expect = 9e-13 Identities = 32/44 (72%), Positives = 41/44 (93%) Frame = +1 Query: 496 MPLYDCMLLLKPHISKPDVMDLISRVGKHIHRRNGVLTELKSFG 627 MP YDCMLLLKPH++K +MDL++RVGKH++RRNGVLT++KSFG Sbjct: 1 MPFYDCMLLLKPHVNKESLMDLVARVGKHVYRRNGVLTDIKSFG 44 >gb|ADR71238.1| 30S ribosomal protein S6B [Hevea brasiliensis] Length = 163 Score = 76.3 bits (186), Expect = 4e-12 Identities = 32/44 (72%), Positives = 40/44 (90%) Frame = +1 Query: 496 MPLYDCMLLLKPHISKPDVMDLISRVGKHIHRRNGVLTELKSFG 627 MPLYDCMLLLKPH+ K +MDL++RVGKH++ RNGVLT++KSFG Sbjct: 1 MPLYDCMLLLKPHVRKEALMDLVARVGKHVYARNGVLTDIKSFG 44 >gb|ADR71237.1| 30S ribosomal protein S6A [Hevea brasiliensis] Length = 163 Score = 75.9 bits (185), Expect = 6e-12 Identities = 32/44 (72%), Positives = 40/44 (90%) Frame = +1 Query: 496 MPLYDCMLLLKPHISKPDVMDLISRVGKHIHRRNGVLTELKSFG 627 MPLYDCMLLLKPH+ K +MDL++RVGKH++ RNGVLT++KSFG Sbjct: 1 MPLYDCMLLLKPHVRKEALMDLVARVGKHVYGRNGVLTDIKSFG 44 >ref|XP_002523537.1| structural constituent of ribosome, putative [Ricinus communis] gi|223537244|gb|EEF38876.1| structural constituent of ribosome, putative [Ricinus communis] Length = 162 Score = 75.5 bits (184), Expect = 8e-12 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = +1 Query: 496 MPLYDCMLLLKPHISKPDVMDLISRVGKHIHRRNGVLTELKSFG 627 MPLYDCMLLLKPHI K V+DL++RVGKH+ RNGVLT++KSFG Sbjct: 1 MPLYDCMLLLKPHIHKEAVIDLVARVGKHVQSRNGVLTDMKSFG 44 >ref|XP_002325157.1| predicted protein [Populus trichocarpa] gi|222866591|gb|EEF03722.1| predicted protein [Populus trichocarpa] Length = 136 Score = 74.3 bits (181), Expect = 2e-11 Identities = 30/44 (68%), Positives = 40/44 (90%) Frame = +1 Query: 496 MPLYDCMLLLKPHISKPDVMDLISRVGKHIHRRNGVLTELKSFG 627 MPLYDCML+LKPH+ K +MDL++RVGKH++ RNGV+T++KSFG Sbjct: 1 MPLYDCMLMLKPHVRKEALMDLVARVGKHVYSRNGVVTDIKSFG 44