BLASTX nr result
ID: Bupleurum21_contig00026093
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00026093 (473 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003533162.1| PREDICTED: uncharacterized protein LOC100804... 62 5e-08 ref|XP_003533161.1| PREDICTED: uncharacterized protein LOC100804... 62 5e-08 gb|ABN07967.1| 4Fe-4S ferredoxin, iron-sulfur binding [Medicago ... 62 6e-08 gb|AEQ61823.1| 4Fe-4S ferredoxin iron-sulfur binding protein [Di... 60 2e-07 ref|XP_002519228.1| conserved hypothetical protein [Ricinus comm... 59 3e-07 >ref|XP_003533162.1| PREDICTED: uncharacterized protein LOC100804088 isoform 2 [Glycine max] Length = 439 Score = 62.0 bits (149), Expect = 5e-08 Identities = 31/42 (73%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = -3 Query: 471 IVGRILNSMQDTHGHVC-IEDHPKHLMMALTEALALVGPIKC 349 IVGRIL SMQ HG IE+HP+HL+MAL EALALVGPIKC Sbjct: 397 IVGRILRSMQSQHGAAASIEEHPQHLLMALKEALALVGPIKC 438 >ref|XP_003533161.1| PREDICTED: uncharacterized protein LOC100804088 isoform 1 [Glycine max] Length = 445 Score = 62.0 bits (149), Expect = 5e-08 Identities = 31/42 (73%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = -3 Query: 471 IVGRILNSMQDTHGHVC-IEDHPKHLMMALTEALALVGPIKC 349 IVGRIL SMQ HG IE+HP+HL+MAL EALALVGPIKC Sbjct: 403 IVGRILRSMQSQHGAAASIEEHPQHLLMALKEALALVGPIKC 444 >gb|ABN07967.1| 4Fe-4S ferredoxin, iron-sulfur binding [Medicago truncatula] gi|388522513|gb|AFK49318.1| unknown [Medicago truncatula] Length = 425 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/42 (69%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = -3 Query: 471 IVGRILNSMQDTHGHVC-IEDHPKHLMMALTEALALVGPIKC 349 IVGR+L SMQ HG IEDHP+HL++AL EALALVGP+KC Sbjct: 383 IVGRVLRSMQSQHGGAASIEDHPEHLLLALREALALVGPVKC 424 >gb|AEQ61823.1| 4Fe-4S ferredoxin iron-sulfur binding protein [Dimocarpus longan] Length = 109 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/45 (60%), Positives = 32/45 (71%) Frame = -3 Query: 471 IVGRILNSMQDTHGHVCIEDHPKHLMMALTEALALVGPIKCYPSY 337 IVG +LNS+Q HG IEDHP HL+ AL ALALVG +KCY + Sbjct: 61 IVGMVLNSLQSQHGLALIEDHPDHLLEALQHALALVGTVKCYDPF 105 >ref|XP_002519228.1| conserved hypothetical protein [Ricinus communis] gi|223541543|gb|EEF43092.1| conserved hypothetical protein [Ricinus communis] Length = 421 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = -3 Query: 471 IVGRILNSMQDTHGHVCIEDHPKHLMMALTEALALVGPIKCYPS 340 IVGR+L SMQ H C+EDHP+HL AL EAL LVG +K +P+ Sbjct: 377 IVGRVLRSMQSQHEFACVEDHPEHLFEALKEALGLVGTVKRFPA 420