BLASTX nr result
ID: Bupleurum21_contig00025881
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00025881 (397 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003612608.1| Replication protein A 70 kDa DNA-binding sub... 77 2e-12 gb|ABN06084.1| Polynucleotidyl transferase, Ribonuclease H fold ... 74 2e-11 gb|ABD32189.2| Polynucleotidyl transferase, Ribonuclease H fold ... 74 2e-11 gb|EEC79285.1| hypothetical protein OsI_20087 [Oryza sativa Indi... 72 6e-11 gb|ABD28498.2| Polynucleotidyl transferase, Ribonuclease H fold ... 71 8e-11 >ref|XP_003612608.1| Replication protein A 70 kDa DNA-binding subunit [Medicago truncatula] gi|355513943|gb|AES95566.1| Replication protein A 70 kDa DNA-binding subunit [Medicago truncatula] Length = 1723 Score = 76.6 bits (187), Expect = 2e-12 Identities = 31/66 (46%), Positives = 42/66 (63%) Frame = +3 Query: 60 WGKLWRLSIPNKVKIFLWHFCRNNVPVRKRLRSKGVSLPILCPMCESDVEHLLHVFFDCP 239 W LW L +P KVK FLW CRN +P R RL+ +GV+ C +CE++ E +H+FF C Sbjct: 1417 WVLLWNLKVPPKVKTFLWRSCRNALPTRVRLQDRGVNCTKTCALCENEDEDSMHLFFYCT 1476 Query: 240 FASQCW 257 + QCW Sbjct: 1477 KSRQCW 1482 >gb|ABN06084.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula] Length = 519 Score = 73.6 bits (179), Expect = 2e-11 Identities = 33/92 (35%), Positives = 48/92 (52%) Frame = +3 Query: 18 ESNVGTANIFQSNGWGKLWRLSIPNKVKIFLWHFCRNNVPVRKRLRSKGVSLPILCPMCE 197 E + T+ + + W +WRL +P K+K F+W CR +P R +LR KGV P C C Sbjct: 154 EELIDTSFLRRPGYWSDIWRLKVPPKIKNFMWRVCRGVLPTRNKLRDKGVQCPEACVNCS 213 Query: 198 SDVEHLLHVFFDCPFASQCWMLELYRRELRYA 293 + E + H+F C F Q W L E++ A Sbjct: 214 TTSEDVKHLFCVCTFDVQVWQLSDLWSEIQQA 245 >gb|ABD32189.2| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula] Length = 612 Score = 73.6 bits (179), Expect = 2e-11 Identities = 33/92 (35%), Positives = 48/92 (52%) Frame = +3 Query: 18 ESNVGTANIFQSNGWGKLWRLSIPNKVKIFLWHFCRNNVPVRKRLRSKGVSLPILCPMCE 197 E + T+ + + W +WRL +P K+K F+W CR +P R +LR KGV P C C Sbjct: 247 EELIDTSFLRRPGYWSDIWRLKVPPKIKNFMWRVCRGVLPTRNKLRDKGVQCPEACVNCS 306 Query: 198 SDVEHLLHVFFDCPFASQCWMLELYRRELRYA 293 + E + H+F C F Q W L E++ A Sbjct: 307 TTSEDVKHLFCVCTFDVQVWQLSDLWSEIQQA 338 >gb|EEC79285.1| hypothetical protein OsI_20087 [Oryza sativa Indica Group] gi|218196859|gb|EEC79286.1| hypothetical protein OsI_20088 [Oryza sativa Indica Group] Length = 216 Score = 71.6 bits (174), Expect = 6e-11 Identities = 26/66 (39%), Positives = 39/66 (59%) Frame = +3 Query: 60 WGKLWRLSIPNKVKIFLWHFCRNNVPVRKRLRSKGVSLPILCPMCESDVEHLLHVFFDCP 239 W K+W + +PNK+K+F+W N++PVR +R +G+ LCPMC E H+F C Sbjct: 108 WEKIWNMEVPNKIKMFVWRLAHNSLPVRCNIRRRGMESDNLCPMCNRFDEDCGHLFLKCK 167 Query: 240 FASQCW 257 +CW Sbjct: 168 GVKECW 173 >gb|ABD28498.2| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula] Length = 424 Score = 71.2 bits (173), Expect = 8e-11 Identities = 32/80 (40%), Positives = 45/80 (56%), Gaps = 1/80 (1%) Frame = +3 Query: 21 SNVGTANIFQSNG-WGKLWRLSIPNKVKIFLWHFCRNNVPVRKRLRSKGVSLPILCPMCE 197 +N N + NG W +W L +P KVK F+W CRN +P R +L+S+GV P+ C + Sbjct: 199 NNNTALNQHRVNGSWNSIWNLKLPPKVKNFMWRACRNCLPTRVKLQSRGVQCPMDCAVYA 258 Query: 198 SDVEHLLHVFFDCPFASQCW 257 E H+FFDC + CW Sbjct: 259 GPYEDSSHLFFDCGKSISCW 278