BLASTX nr result
ID: Bupleurum21_contig00025871
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00025871 (535 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EAY82739.1| hypothetical protein OsI_37948 [Oryza sativa Indi... 59 6e-07 >gb|EAY82739.1| hypothetical protein OsI_37948 [Oryza sativa Indica Group] Length = 985 Score = 58.5 bits (140), Expect = 6e-07 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -3 Query: 122 LICAHQASFALWEVKQRLKRTFRNDSIEDIFIYIHGYGYL 3 LICA QA+ A WEVK+ LKRTFRNDSIEDI+I+ + Y L Sbjct: 771 LICARQANLAFWEVKEGLKRTFRNDSIEDIYIHRNAYSGL 810