BLASTX nr result
ID: Bupleurum21_contig00025798
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00025798 (329 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA58701.1| inorganic pyrophosphatase [Nicotiana tabacum] 82 6e-14 dbj|BAA23649.1| proton pyrophosphatase [Vigna radiata] 82 6e-14 sp|P21616.3|AVP_PHAAU RecName: Full=Pyrophosphate-energized vacu... 82 6e-14 dbj|BAC41250.1| vacuolar proton-inorganic pyrophosphatase [Pyrus... 82 6e-14 gb|AEI17666.1| vacuolar H+-pyrophosphatase [Salicornia europaea] 82 6e-14 >emb|CAA58701.1| inorganic pyrophosphatase [Nicotiana tabacum] Length = 765 Score = 81.6 bits (200), Expect = 6e-14 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -1 Query: 329 DPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLIFKIF 210 DPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGL+FKIF Sbjct: 726 DPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 765 >dbj|BAA23649.1| proton pyrophosphatase [Vigna radiata] Length = 766 Score = 81.6 bits (200), Expect = 6e-14 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -1 Query: 329 DPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLIFKIF 210 DPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGL+FKIF Sbjct: 727 DPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 766 >sp|P21616.3|AVP_PHAAU RecName: Full=Pyrophosphate-energized vacuolar membrane proton pump; AltName: Full=Pyrophosphate-energized inorganic pyrophosphatase; Short=H(+)-PPase; AltName: Full=Vacuolar H(+)-pyrophosphatase gi|951323|gb|AAC49175.1| pyrophosphatase [Vigna radiata] Length = 765 Score = 81.6 bits (200), Expect = 6e-14 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -1 Query: 329 DPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLIFKIF 210 DPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGL+FKIF Sbjct: 726 DPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 765 >dbj|BAC41250.1| vacuolar proton-inorganic pyrophosphatase [Pyrus communis] Length = 767 Score = 81.6 bits (200), Expect = 6e-14 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -1 Query: 329 DPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLIFKIF 210 DPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGL+FKIF Sbjct: 728 DPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 767 >gb|AEI17666.1| vacuolar H+-pyrophosphatase [Salicornia europaea] Length = 763 Score = 81.6 bits (200), Expect = 6e-14 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -1 Query: 329 DPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLIFKIF 210 DPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGL+FKIF Sbjct: 723 DPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 762