BLASTX nr result
ID: Bupleurum21_contig00025763
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00025763 (677 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN82340.1| hypothetical protein VITISV_036992 [Vitis vinifera] 56 7e-06 >emb|CAN82340.1| hypothetical protein VITISV_036992 [Vitis vinifera] Length = 1723 Score = 55.8 bits (133), Expect = 7e-06 Identities = 26/52 (50%), Positives = 37/52 (71%) Frame = -1 Query: 158 IPDNISFPSLEMLFLDSHIDLAYIPSLFFEKMPALQVLDMSNTSIKTLPPSI 3 +P + P L LFL ++ L IP +FFE MP+LQ LD+SNT+I++LPPS+ Sbjct: 454 LPKSPYCPQLRALFLQANHGLRVIPPMFFEGMPSLQFLDLSNTAIRSLPPSL 505