BLASTX nr result
ID: Bupleurum21_contig00025694
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00025694 (257 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281200.1| PREDICTED: abscisic acid receptor PYL9-like ... 74 2e-11 ref|XP_002523369.1| conserved hypothetical protein [Ricinus comm... 74 2e-11 emb|CAN82501.1| hypothetical protein VITISV_004915 [Vitis vinife... 74 2e-11 ref|XP_004133818.1| PREDICTED: abscisic acid receptor PYL9-like ... 72 4e-11 gb|AAT35532.1| CAPIP1 [Capsicum annuum] 71 8e-11 >ref|XP_002281200.1| PREDICTED: abscisic acid receptor PYL9-like [Vitis vinifera] Length = 192 Score = 73.6 bits (179), Expect = 2e-11 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -2 Query: 256 SFQVDVPNGNTKDETCYFVTALINCNLKSLAEVSERMAML 137 SF VDVP GNTKD+TCYFV ALINCNLK LAEVSERMAML Sbjct: 144 SFVVDVPEGNTKDDTCYFVRALINCNLKCLAEVSERMAML 183 >ref|XP_002523369.1| conserved hypothetical protein [Ricinus communis] gi|223537457|gb|EEF39085.1| conserved hypothetical protein [Ricinus communis] Length = 186 Score = 73.6 bits (179), Expect = 2e-11 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = -2 Query: 256 SFQVDVPNGNTKDETCYFVTALINCNLKSLAEVSERMAMLNC 131 SF VDVP+GNTKDETCYFV ALI CNLKSLA+VSERMA+ +C Sbjct: 138 SFVVDVPDGNTKDETCYFVKALIKCNLKSLADVSERMAVQDC 179 >emb|CAN82501.1| hypothetical protein VITISV_004915 [Vitis vinifera] gi|297745421|emb|CBI40501.3| unnamed protein product [Vitis vinifera] Length = 178 Score = 73.6 bits (179), Expect = 2e-11 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -2 Query: 256 SFQVDVPNGNTKDETCYFVTALINCNLKSLAEVSERMAML 137 SF VDVP GNTKD+TCYFV ALINCNLK LAEVSERMAML Sbjct: 130 SFVVDVPEGNTKDDTCYFVRALINCNLKCLAEVSERMAML 169 >ref|XP_004133818.1| PREDICTED: abscisic acid receptor PYL9-like [Cucumis sativus] gi|449477916|ref|XP_004155161.1| PREDICTED: abscisic acid receptor PYL9-like [Cucumis sativus] Length = 185 Score = 72.4 bits (176), Expect = 4e-11 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -2 Query: 256 SFQVDVPNGNTKDETCYFVTALINCNLKSLAEVSERMAM 140 SF VDVPNGNTKDETCYFV ALI CNLKSLA+VSERMA+ Sbjct: 138 SFVVDVPNGNTKDETCYFVKALIRCNLKSLADVSERMAV 176 >gb|AAT35532.1| CAPIP1 [Capsicum annuum] Length = 186 Score = 71.2 bits (173), Expect = 8e-11 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -2 Query: 256 SFQVDVPNGNTKDETCYFVTALINCNLKSLAEVSERMAM 140 SF VDVP GNTKDETCYFV ALINCNLKSLA+VSER+A+ Sbjct: 138 SFVVDVPQGNTKDETCYFVEALINCNLKSLADVSERLAV 176