BLASTX nr result
ID: Bupleurum21_contig00025646
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00025646 (470 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530188.1| conserved hypothetical protein [Ricinus comm... 76 2e-12 ref|XP_004147091.1| PREDICTED: F-box/LRR-repeat protein At4g2942... 67 2e-09 >ref|XP_002530188.1| conserved hypothetical protein [Ricinus communis] gi|223530307|gb|EEF32202.1| conserved hypothetical protein [Ricinus communis] Length = 460 Score = 76.3 bits (186), Expect = 2e-12 Identities = 48/122 (39%), Positives = 70/122 (57%), Gaps = 1/122 (0%) Frame = +1 Query: 10 PCLQVFNFIDGICLRA-NIHHVNLKELNWTSINDGAGLGSSLSIFTPNLTKLELELYTLV 186 PCL+V N + LR IH +L+ WT N +SLSIF PNL KLEL Sbjct: 206 PCLKVLNLVGVGGLREPKIHLYHLRTCRWTVSN----APNSLSIFAPNLLKLELNCIEPR 261 Query: 187 KLSIHAPLLSHFHLALERVHEFNVEKFQTLKTLRLVSSRLLHYILSCFPSCITVQNLTFD 366 L + PLLS F+L++ + ++F V++ LK L+L S+ +L ++ FPS +V+ LT D Sbjct: 262 SLILETPLLSDFYLSIRKANKFKVKQLHDLKILQLESTDILS-LIRLFPSNSSVERLTVD 320 Query: 367 TP 372 +P Sbjct: 321 SP 322 >ref|XP_004147091.1| PREDICTED: F-box/LRR-repeat protein At4g29420-like [Cucumis sativus] gi|449503313|ref|XP_004161940.1| PREDICTED: F-box/LRR-repeat protein At4g29420-like [Cucumis sativus] Length = 449 Score = 67.0 bits (162), Expect = 2e-09 Identities = 53/156 (33%), Positives = 73/156 (46%), Gaps = 1/156 (0%) Frame = +1 Query: 4 SLPCLQVFNFID-GICLRANIHHVNLKELNWTSINDGAGLGSSLSIFTPNLTKLELELYT 180 + P L+V N I G I ++LK WT N SL I+ P+L+KLEL+ Sbjct: 199 NFPHLEVLNLIGVGGLNEPKIRLLHLKTCKWTVSNAPV----SLCIYAPSLSKLELKCVK 254 Query: 181 LVKLSIHAPLLSHFHLALERVHEFNVEKFQTLKTLRLVSSRLLHYILSCFPSCITVQNLT 360 L I P+LS FH LE V++F L+ L L R LH +++ F S T++ LT Sbjct: 255 PKFLIIETPMLSDFHFCLEDASGLQVDEFPCLRKLHLHFPR-LHSLITTFSSARTLKELT 313 Query: 361 FDTPNSEYWSLSHQRGPLPRNERIEFSQVFTIFPNV 468 DT QR + + VF IFPN+ Sbjct: 314 LDT---------MQRAESIESVKFCLDTVFEIFPNL 340