BLASTX nr result
ID: Bupleurum21_contig00025608
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00025608 (322 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004166632.1| PREDICTED: uncharacterized LOC101223019 [Cuc... 58 9e-07 ref|XP_004137599.1| PREDICTED: uncharacterized protein LOC101223... 58 9e-07 >ref|XP_004166632.1| PREDICTED: uncharacterized LOC101223019 [Cucumis sativus] Length = 302 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/60 (46%), Positives = 37/60 (61%) Frame = -1 Query: 310 LAHTSKKVSQKAFAFSKKIDPNLKFKLFPRSDLYPKIFEDACPDRDDIALYFYPTNSERS 131 LA V + + S+KI P L+ KL RSD++ +F D CPD D+ALYF+P N ERS Sbjct: 10 LAKPPCAVYGRVYELSRKIPPILQVKLVSRSDIWNDLFHDECPDLADVALYFFPCNIERS 69 >ref|XP_004137599.1| PREDICTED: uncharacterized protein LOC101223019 [Cucumis sativus] Length = 302 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/60 (46%), Positives = 37/60 (61%) Frame = -1 Query: 310 LAHTSKKVSQKAFAFSKKIDPNLKFKLFPRSDLYPKIFEDACPDRDDIALYFYPTNSERS 131 LA V + + S+KI P L+ KL RSD++ +F D CPD D+ALYF+P N ERS Sbjct: 10 LAKPPCAVYGRVYELSRKIPPILQVKLVSRSDIWNDLFHDECPDLADVALYFFPCNIERS 69