BLASTX nr result
ID: Bupleurum21_contig00025595
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00025595 (424 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306710.1| predicted protein [Populus trichocarpa] gi|2... 93 2e-17 ref|XP_002264601.1| PREDICTED: methenyltetrahydrofolate synthase... 92 6e-17 emb|CBI18227.3| unnamed protein product [Vitis vinifera] 92 6e-17 ref|XP_003548100.1| PREDICTED: methenyltetrahydrofolate synthase... 89 3e-16 ref|XP_002524307.1| catalytic, putative [Ricinus communis] gi|22... 89 4e-16 >ref|XP_002306710.1| predicted protein [Populus trichocarpa] gi|222856159|gb|EEE93706.1| predicted protein [Populus trichocarpa] Length = 283 Score = 93.2 bits (230), Expect = 2e-17 Identities = 43/49 (87%), Positives = 48/49 (97%) Frame = +1 Query: 22 GIYWDKLSPEKLSQIRILRQLKSKIERETGQKLPSGPSEKLPPTARRKR 168 GIYWDKLSPEKL+QIRILR+LKS+IERETGQKLP GPSEKLPPTA+R+R Sbjct: 234 GIYWDKLSPEKLAQIRILRELKSRIERETGQKLPCGPSEKLPPTAQRRR 282 >ref|XP_002264601.1| PREDICTED: methenyltetrahydrofolate synthase domain-containing protein-like [Vitis vinifera] Length = 354 Score = 91.7 bits (226), Expect = 6e-17 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = +1 Query: 22 GIYWDKLSPEKLSQIRILRQLKSKIERETGQKLPSGPSEKLPPTARRKR 168 GIYWDKLSPEKL QIRILR+LKS+IE ETGQKLP GPSEKLPPTA+RKR Sbjct: 306 GIYWDKLSPEKLGQIRILRELKSRIEGETGQKLPCGPSEKLPPTAKRKR 354 >emb|CBI18227.3| unnamed protein product [Vitis vinifera] Length = 351 Score = 91.7 bits (226), Expect = 6e-17 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = +1 Query: 22 GIYWDKLSPEKLSQIRILRQLKSKIERETGQKLPSGPSEKLPPTARRKR 168 GIYWDKLSPEKL QIRILR+LKS+IE ETGQKLP GPSEKLPPTA+RKR Sbjct: 303 GIYWDKLSPEKLGQIRILRELKSRIEGETGQKLPCGPSEKLPPTAKRKR 351 >ref|XP_003548100.1| PREDICTED: methenyltetrahydrofolate synthase domain-containing protein-like [Glycine max] Length = 348 Score = 89.4 bits (220), Expect = 3e-16 Identities = 40/49 (81%), Positives = 46/49 (93%) Frame = +1 Query: 22 GIYWDKLSPEKLSQIRILRQLKSKIERETGQKLPSGPSEKLPPTARRKR 168 GIYWDKLSPEKL Q+RILR+LK +IE+ETGQKLP+GPSEKLPPTA+R R Sbjct: 298 GIYWDKLSPEKLGQVRILRELKKRIEQETGQKLPTGPSEKLPPTAQRSR 346 >ref|XP_002524307.1| catalytic, putative [Ricinus communis] gi|223536398|gb|EEF38047.1| catalytic, putative [Ricinus communis] Length = 360 Score = 89.0 bits (219), Expect = 4e-16 Identities = 41/56 (73%), Positives = 49/56 (87%) Frame = +1 Query: 1 STLVVTSGIYWDKLSPEKLSQIRILRQLKSKIERETGQKLPSGPSEKLPPTARRKR 168 +T+ GIYWDKLSPEKL QIRILR+LK +IE ETGQKLP+GPSEKLPPTA+R++ Sbjct: 304 TTIPKPQGIYWDKLSPEKLGQIRILRELKRRIELETGQKLPTGPSEKLPPTAQRRK 359