BLASTX nr result
ID: Bupleurum21_contig00025577
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00025577 (411 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270419.1| PREDICTED: phosphatidylinositol-4-phosphate ... 59 5e-07 ref|XP_002529289.1| phosphatidylinositol-4-phosphate 5-kinase, p... 57 2e-06 >ref|XP_002270419.1| PREDICTED: phosphatidylinositol-4-phosphate 5-kinase 8-like [Vitis vinifera] Length = 789 Score = 58.5 bits (140), Expect = 5e-07 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -2 Query: 113 AQRSSEHILSSGDTYLGDFKGVLPHGKGKYTWLNGTV 3 A+ SE + S+GD Y+G+FKGV PHGKGKYTW +GTV Sbjct: 4 AESLSEKVFSNGDIYVGNFKGVFPHGKGKYTWSDGTV 40 >ref|XP_002529289.1| phosphatidylinositol-4-phosphate 5-kinase, putative [Ricinus communis] gi|223531278|gb|EEF33121.1| phosphatidylinositol-4-phosphate 5-kinase, putative [Ricinus communis] Length = 789 Score = 57.0 bits (136), Expect = 2e-06 Identities = 23/35 (65%), Positives = 28/35 (80%) Frame = -2 Query: 107 RSSEHILSSGDTYLGDFKGVLPHGKGKYTWLNGTV 3 R +LS+GD Y+G+FKGVLPHGKGKY W +GTV Sbjct: 18 RPDTKVLSNGDIYIGEFKGVLPHGKGKYKWTDGTV 52