BLASTX nr result
ID: Bupleurum21_contig00025536
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00025536 (368 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265346.2| PREDICTED: ABC transporter C family member 9... 57 1e-06 >ref|XP_002265346.2| PREDICTED: ABC transporter C family member 9-like [Vitis vinifera] Length = 1484 Score = 57.4 bits (137), Expect = 1e-06 Identities = 41/119 (34%), Positives = 57/119 (47%), Gaps = 3/119 (2%) Frame = -2 Query: 364 SWPQLHTSCLWENASIXXXXXXXXXXXLHSLCRTVSSFDQHRRR-TDIGENDKVEIVGVS 188 +W QL + CLWE+ SI LH + + V +HR TD G S Sbjct: 11 AWLQLSSPCLWEDVSIVLQLGFLGIFLLHLVQKIVGHLWKHRTTVTDKGIEMYPNEAKAS 70 Query: 187 Y--KLCLLCSITLLGSQSFILLGPQSRSRGECNITGQVITSGITQVMPCAITLIALYKV 17 + K ++CS LLG +LL P + S G C V++S + QVM ITLIA+ K+ Sbjct: 71 FSCKASIICSSILLGIHVIVLLMPPNGSEGNCKSPILVLSSEVMQVMIWLITLIAVCKI 129