BLASTX nr result
ID: Bupleurum21_contig00025359
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00025359 (419 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320775.1| predicted protein [Populus trichocarpa] gi|2... 68 9e-10 ref|XP_002269433.1| PREDICTED: cell division protein FtsY homolo... 68 9e-10 ref|XP_004133877.1| PREDICTED: cell division protein FtsY homolo... 67 2e-09 ref|XP_003528876.1| PREDICTED: cell division protein ftsY homolo... 67 2e-09 dbj|BAJ86455.1| predicted protein [Hordeum vulgare subsp. vulgar... 67 2e-09 >ref|XP_002320775.1| predicted protein [Populus trichocarpa] gi|222861548|gb|EEE99090.1| predicted protein [Populus trichocarpa] Length = 365 Score = 67.8 bits (164), Expect = 9e-10 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 417 VVDELGIPVKFVGVGEGVDDLQPFDAETFVDAIFS 313 VVDELGIPVKFVGVGEGV+DLQPFDAE FV+AIFS Sbjct: 331 VVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFS 365 >ref|XP_002269433.1| PREDICTED: cell division protein FtsY homolog, chloroplastic [Vitis vinifera] gi|296089055|emb|CBI38758.3| unnamed protein product [Vitis vinifera] Length = 367 Score = 67.8 bits (164), Expect = 9e-10 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 417 VVDELGIPVKFVGVGEGVDDLQPFDAETFVDAIFS 313 VVDELGIPVKFVGVGEGV+DLQPFDAE FV+AIFS Sbjct: 333 VVDELGIPVKFVGVGEGVEDLQPFDAEVFVNAIFS 367 >ref|XP_004133877.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like [Cucumis sativus] gi|449480150|ref|XP_004155813.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like [Cucumis sativus] Length = 368 Score = 66.6 bits (161), Expect = 2e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 417 VVDELGIPVKFVGVGEGVDDLQPFDAETFVDAIFS 313 VVDELGIPVKFVGVGEG++DLQPFD E FVDAIFS Sbjct: 334 VVDELGIPVKFVGVGEGLEDLQPFDPEAFVDAIFS 368 >ref|XP_003528876.1| PREDICTED: cell division protein ftsY homolog [Glycine max] Length = 372 Score = 66.6 bits (161), Expect = 2e-09 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -3 Query: 417 VVDELGIPVKFVGVGEGVDDLQPFDAETFVDAIF 316 VVDELGIPVKFVGVGEGV+DLQPFDAE+FV+AIF Sbjct: 338 VVDELGIPVKFVGVGEGVEDLQPFDAESFVNAIF 371 >dbj|BAJ86455.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326532852|dbj|BAJ89271.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 355 Score = 66.6 bits (161), Expect = 2e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 417 VVDELGIPVKFVGVGEGVDDLQPFDAETFVDAIF 316 VVDELGIPVKFVGVGEGV+DLQPFDAE FV+AIF Sbjct: 321 VVDELGIPVKFVGVGEGVEDLQPFDAEAFVEAIF 354