BLASTX nr result
ID: Bupleurum21_contig00025017
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00025017 (353 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512628.1| conserved hypothetical protein [Ricinus comm... 72 5e-11 ref|XP_002522452.1| nucleic acid binding protein, putative [Rici... 66 3e-09 emb|CAN76892.1| hypothetical protein VITISV_005356 [Vitis vinifera] 65 4e-09 ref|XP_002529689.1| conserved hypothetical protein [Ricinus comm... 65 8e-09 ref|XP_003598202.1| 60S ribosomal protein L23 [Medicago truncatu... 64 1e-08 >ref|XP_002512628.1| conserved hypothetical protein [Ricinus communis] gi|223548589|gb|EEF50080.1| conserved hypothetical protein [Ricinus communis] Length = 223 Score = 72.0 bits (175), Expect = 5e-11 Identities = 35/90 (38%), Positives = 55/90 (61%) Frame = -1 Query: 272 VGIVQPEFAEVMAIKEALSWMEKNGWHEGILETDCLVAAQAIRSRVQMHSPFGVVVEECR 93 +G+ +P AE +A+KEA+ W + + + E+D +A AIRS S FG++++ECR Sbjct: 107 LGLFEPRLAEAVALKEAIRWAIQMRFSLVVFESDSKIAVDAIRSLAADWSEFGIIIDECR 166 Query: 92 ALLNRLNKVTLLFVRRSANMAAHYVAKMSY 3 +LL+ + FV+R ANM AH +A SY Sbjct: 167 SLLSLGLNFQVYFVKRQANMVAHVLAMSSY 196 >ref|XP_002522452.1| nucleic acid binding protein, putative [Ricinus communis] gi|223538337|gb|EEF39944.1| nucleic acid binding protein, putative [Ricinus communis] Length = 483 Score = 66.2 bits (160), Expect = 3e-09 Identities = 33/85 (38%), Positives = 50/85 (58%) Frame = -1 Query: 266 IVQPEFAEVMAIKEALSWMEKNGWHEGILETDCLVAAQAIRSRVQMHSPFGVVVEECRAL 87 I P+ AE A+KEALSW+ G E +ETDCL + + + +S ++++C+ L Sbjct: 390 IANPDVAEAWALKEALSWIHAKGMEEVQIETDCLRNIELLEEELHPNSYLLCLLKDCQDL 449 Query: 86 LNRLNKVTLLFVRRSANMAAHYVAK 12 L LN+ L+FV SAN AH ++K Sbjct: 450 LRVLNRCNLVFVYGSANTVAHMISK 474 >emb|CAN76892.1| hypothetical protein VITISV_005356 [Vitis vinifera] Length = 1793 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/81 (37%), Positives = 49/81 (60%) Frame = -1 Query: 254 EFAEVMAIKEALSWMEKNGWHEGILETDCLVAAQAIRSRVQMHSPFGVVVEECRALLNRL 75 E E + ++E LSW+ + ++ETDCL+ QAI+ + + FG ++ +C +L L Sbjct: 1686 EVVEALGVREVLSWIHERSRSRIVVETDCLLVVQAIQHKSCPNMSFGFIIADCLDVLQHL 1745 Query: 74 NKVTLLFVRRSANMAAHYVAK 12 V +++ RRSAN AAH +AK Sbjct: 1746 VDVQVVYARRSANSAAHCLAK 1766 >ref|XP_002529689.1| conserved hypothetical protein [Ricinus communis] gi|223530837|gb|EEF32700.1| conserved hypothetical protein [Ricinus communis] Length = 119 Score = 64.7 bits (156), Expect = 8e-09 Identities = 35/99 (35%), Positives = 60/99 (60%) Frame = -1 Query: 299 LLQARTVVSVGIVQPEFAEVMAIKEALSWMEKNGWHEGILETDCLVAAQAIRSRVQMHSP 120 ++ AR G P AE ++I+EALSW+++ + E I+E+D L +A+++ S Sbjct: 1 MVMARADRIPGNYTPREAEAISIREALSWLKQQIFEECIIESDALQVIEALKAP-SSQSC 59 Query: 119 FGVVVEECRALLNRLNKVTLLFVRRSANMAAHYVAKMSY 3 F +++++C+ L+ +V FVRRSAN AA VA+ +Y Sbjct: 60 FHLIIDDCKHLVQHFRQVHFQFVRRSANTAAQIVARGAY 98 >ref|XP_003598202.1| 60S ribosomal protein L23 [Medicago truncatula] gi|355487250|gb|AES68453.1| 60S ribosomal protein L23 [Medicago truncatula] Length = 547 Score = 64.3 bits (155), Expect = 1e-08 Identities = 32/101 (31%), Positives = 55/101 (54%) Frame = -1 Query: 308 RGELLQARTVVSVGIVQPEFAEVMAIKEALSWMEKNGWHEGILETDCLVAAQAIRSRVQM 129 RG L+A T G P+ AE + +++A+ W+ + LE DC + +I + Sbjct: 90 RGRFLKAATNWYEGCPPPQEAEAVGLRDAILWLGQLELSNVQLELDCKLVVDSIYDKNNN 149 Query: 128 HSPFGVVVEECRALLNRLNKVTLLFVRRSANMAAHYVAKMS 6 + FG ++++CR+LL + + FVRR AN+ AH A++S Sbjct: 150 QAEFGSIIDDCRSLLQQFTNFKISFVRRQANVVAHSFARVS 190