BLASTX nr result
ID: Bupleurum21_contig00024925
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00024925 (275 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003535944.1| PREDICTED: protein fat-free homolog isoform ... 74 9e-12 ref|XP_003535943.1| PREDICTED: protein fat-free homolog isoform ... 74 9e-12 ref|XP_003518811.1| PREDICTED: protein fat-free-like [Glycine max] 74 9e-12 ref|XP_003591408.1| Fat-free-like protein [Medicago truncatula] ... 74 9e-12 ref|XP_003591407.1| Fat-free-like protein [Medicago truncatula] ... 74 9e-12 >ref|XP_003535944.1| PREDICTED: protein fat-free homolog isoform 2 [Glycine max] Length = 749 Score = 74.3 bits (181), Expect = 9e-12 Identities = 35/45 (77%), Positives = 38/45 (84%) Frame = +3 Query: 3 EDEAAVDFLLDEVTVATAERCFDPVPLEAPILDKLIHAKLKKNSD 137 EDEAA+DFLLDEV VATAERC DP+PLE PILDKLI AKL K + Sbjct: 699 EDEAAIDFLLDEVIVATAERCLDPIPLEPPILDKLIRAKLAKTEE 743 >ref|XP_003535943.1| PREDICTED: protein fat-free homolog isoform 1 [Glycine max] Length = 771 Score = 74.3 bits (181), Expect = 9e-12 Identities = 35/45 (77%), Positives = 38/45 (84%) Frame = +3 Query: 3 EDEAAVDFLLDEVTVATAERCFDPVPLEAPILDKLIHAKLKKNSD 137 EDEAA+DFLLDEV VATAERC DP+PLE PILDKLI AKL K + Sbjct: 721 EDEAAIDFLLDEVIVATAERCLDPIPLEPPILDKLIRAKLAKTEE 765 >ref|XP_003518811.1| PREDICTED: protein fat-free-like [Glycine max] Length = 755 Score = 74.3 bits (181), Expect = 9e-12 Identities = 35/45 (77%), Positives = 38/45 (84%) Frame = +3 Query: 3 EDEAAVDFLLDEVTVATAERCFDPVPLEAPILDKLIHAKLKKNSD 137 EDEAA+DFLLDEV VATAERC DP+PLE PILDKLI AKL K + Sbjct: 705 EDEAAIDFLLDEVIVATAERCLDPIPLEPPILDKLIRAKLAKTEE 749 >ref|XP_003591408.1| Fat-free-like protein [Medicago truncatula] gi|355480456|gb|AES61659.1| Fat-free-like protein [Medicago truncatula] Length = 758 Score = 74.3 bits (181), Expect = 9e-12 Identities = 35/45 (77%), Positives = 38/45 (84%) Frame = +3 Query: 3 EDEAAVDFLLDEVTVATAERCFDPVPLEAPILDKLIHAKLKKNSD 137 EDEAAVDFLLDEV VATAERC DP+PLE PILDKL+ AKL K + Sbjct: 707 EDEAAVDFLLDEVIVATAERCLDPIPLEPPILDKLVQAKLAKTKE 751 >ref|XP_003591407.1| Fat-free-like protein [Medicago truncatula] gi|355480455|gb|AES61658.1| Fat-free-like protein [Medicago truncatula] Length = 773 Score = 74.3 bits (181), Expect = 9e-12 Identities = 35/45 (77%), Positives = 38/45 (84%) Frame = +3 Query: 3 EDEAAVDFLLDEVTVATAERCFDPVPLEAPILDKLIHAKLKKNSD 137 EDEAAVDFLLDEV VATAERC DP+PLE PILDKL+ AKL K + Sbjct: 722 EDEAAVDFLLDEVIVATAERCLDPIPLEPPILDKLVQAKLAKTKE 766