BLASTX nr result
ID: Bupleurum21_contig00024173
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00024173 (360 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313579.1| predicted protein [Populus trichocarpa] gi|2... 59 5e-07 ref|XP_002263764.1| PREDICTED: UPF0712 protein C7orf64 homolog [... 57 2e-06 emb|CAN63941.1| hypothetical protein VITISV_032503 [Vitis vinifera] 57 2e-06 ref|XP_002525357.1| nucleic acid binding protein, putative [Rici... 56 3e-06 ref|XP_004161064.1| PREDICTED: RNA-binding protein 48-like [Cucu... 55 5e-06 >ref|XP_002313579.1| predicted protein [Populus trichocarpa] gi|222849987|gb|EEE87534.1| predicted protein [Populus trichocarpa] Length = 234 Score = 58.5 bits (140), Expect = 5e-07 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 1/40 (2%) Frame = +1 Query: 1 SMNQTVQLVREKLHKIQSSADHLEVG-LPKKPRVDNRRRI 117 SMNQTV+LVREKL+KIQSS++HL+ G + KK RVDNRRRI Sbjct: 195 SMNQTVRLVREKLNKIQSSSEHLQAGPVSKKARVDNRRRI 234 >ref|XP_002263764.1| PREDICTED: UPF0712 protein C7orf64 homolog [Vitis vinifera] gi|297739067|emb|CBI28556.3| unnamed protein product [Vitis vinifera] Length = 230 Score = 56.6 bits (135), Expect = 2e-06 Identities = 31/40 (77%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = +1 Query: 1 SMNQTVQLVREKLHKIQSSADHLEVGLP-KKPRVDNRRRI 117 SMNQTV+LVREKL KIQSS+ HLE G KK RVDNRRRI Sbjct: 191 SMNQTVRLVREKLDKIQSSSQHLEAGPAFKKTRVDNRRRI 230 >emb|CAN63941.1| hypothetical protein VITISV_032503 [Vitis vinifera] Length = 230 Score = 56.6 bits (135), Expect = 2e-06 Identities = 31/40 (77%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = +1 Query: 1 SMNQTVQLVREKLHKIQSSADHLEVGLP-KKPRVDNRRRI 117 SMNQTV+LVREKL KIQSS+ HLE G KK RVDNRRRI Sbjct: 191 SMNQTVRLVREKLDKIQSSSQHLEAGPAFKKTRVDNRRRI 230 >ref|XP_002525357.1| nucleic acid binding protein, putative [Ricinus communis] gi|223535320|gb|EEF36995.1| nucleic acid binding protein, putative [Ricinus communis] Length = 216 Score = 55.8 bits (133), Expect = 3e-06 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 1/40 (2%) Frame = +1 Query: 1 SMNQTVQLVREKLHKIQSSADHLE-VGLPKKPRVDNRRRI 117 SMNQTV LVREKL+KIQSS++HL+ V KK RVDNRRRI Sbjct: 177 SMNQTVSLVREKLNKIQSSSEHLQAVPASKKSRVDNRRRI 216 >ref|XP_004161064.1| PREDICTED: RNA-binding protein 48-like [Cucumis sativus] Length = 258 Score = 55.5 bits (132), Expect = 5e-06 Identities = 29/40 (72%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = +1 Query: 1 SMNQTVQLVREKLHKIQSSADHLEVG-LPKKPRVDNRRRI 117 SMNQTV LVREKL KIQSS++HL+ G KK R+DNRRRI Sbjct: 219 SMNQTVHLVREKLDKIQSSSEHLQAGPASKKSRMDNRRRI 258