BLASTX nr result
ID: Bupleurum21_contig00024008
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00024008 (422 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAE72071.1| Cyclin B1-3 [Daucus carota] 71 1e-10 gb|AAC41681.1| mitotic cyclin [Petroselinum crispum] 70 2e-10 dbj|BAE72072.1| Cyclin B1-4 [Daucus carota] 67 2e-09 dbj|BAA20411.1| B-type cyclin [Catharanthus roseus] 64 1e-08 dbj|BAA20413.1| B-type cyclin [Catharanthus roseus] 64 1e-08 >dbj|BAE72071.1| Cyclin B1-3 [Daucus carota] Length = 444 Score = 70.9 bits (172), Expect = 1e-10 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 1/48 (2%) Frame = +3 Query: 48 G*EAVKQKNMAEGEGRIRRALGDIGNFVTVSGIDGK-QKVPQVSRPVT 188 G EAVKQKNMA GEGR RRALGDIGN VTV GI+GK Q++P+V RPVT Sbjct: 16 GEEAVKQKNMAAGEGRNRRALGDIGNLVTVHGIEGKQQQIPRVIRPVT 63 >gb|AAC41681.1| mitotic cyclin [Petroselinum crispum] Length = 443 Score = 69.7 bits (169), Expect = 2e-10 Identities = 39/55 (70%), Positives = 43/55 (78%), Gaps = 1/55 (1%) Frame = +3 Query: 30 NS*KALG*EAVKQKNMAEGEGRIRRALGDIGNFVTVSGIDGK-QKVPQVSRPVTR 191 N +A G AVKQKNMA EGR RRALGDIGN VT GI+GK Q++PQVSRPVTR Sbjct: 10 NRVEAAGGGAVKQKNMAAVEGRNRRALGDIGNLVTGHGIEGKQQQIPQVSRPVTR 64 >dbj|BAE72072.1| Cyclin B1-4 [Daucus carota] Length = 455 Score = 67.0 bits (162), Expect = 2e-09 Identities = 36/46 (78%), Positives = 37/46 (80%), Gaps = 1/46 (2%) Frame = +3 Query: 57 AVKQKNMAEGEGRIRRALGDIGNFVTVSGIDG-KQKVPQVSRPVTR 191 AVK KNMA GE R RRALGDIGN VTV GIDG KQ +PQ SRPVTR Sbjct: 18 AVKPKNMAGGEVRNRRALGDIGNLVTVRGIDGKKQPIPQASRPVTR 63 >dbj|BAA20411.1| B-type cyclin [Catharanthus roseus] Length = 436 Score = 64.3 bits (155), Expect = 1e-08 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = +3 Query: 60 VKQKNMAEGEGRIRRALGDIGNFVTVSGIDGKQKVPQVSRPVTR 191 +KQKNMA GEG+IRRALGDIGN VTV G++GK +PQVSRP+TR Sbjct: 21 MKQKNMA-GEGKIRRALGDIGNLVTVRGVEGK-PLPQVSRPITR 62 >dbj|BAA20413.1| B-type cyclin [Catharanthus roseus] Length = 186 Score = 64.3 bits (155), Expect = 1e-08 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = +3 Query: 60 VKQKNMAEGEGRIRRALGDIGNFVTVSGIDGKQKVPQVSRPVTR 191 +KQKNMA GEG+IRRALGDIGN VTV G++GK +PQVSRP+TR Sbjct: 21 MKQKNMA-GEGKIRRALGDIGNLVTVRGVEGK-PLPQVSRPITR 62