BLASTX nr result
ID: Bupleurum21_contig00022836
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00022836 (299 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002316810.1| predicted protein [Populus trichocarpa] gi|2... 69 6e-12 gb|ADI60302.1| ER luminal protein receptor 2a [Nicotiana bentham... 68 1e-11 gb|ACD56623.1| ERD2-like protein [Gossypium raimondii] 68 1e-11 ref|XP_002522261.1| er lumen protein retaining receptor, putativ... 70 1e-11 ref|XP_002267990.1| PREDICTED: ER lumen protein retaining recept... 68 2e-11 >ref|XP_002316810.1| predicted protein [Populus trichocarpa] gi|222859875|gb|EEE97422.1| predicted protein [Populus trichocarpa] Length = 215 Score = 68.9 bits (167), Expect(2) = 6e-12 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -3 Query: 264 LSCVSGLVQTAMYADFFYYFFISWKNNVKLQLPA 163 ++CVSGLVQTA+YADFFYY+FISWKNN KLQLPA Sbjct: 182 IACVSGLVQTALYADFFYYYFISWKNNAKLQLPA 215 Score = 26.2 bits (56), Expect(2) = 6e-12 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 299 IYRYITEPHFTLYLA 255 IYRY +PHFT ++A Sbjct: 169 IYRYFIDPHFTRWIA 183 >gb|ADI60302.1| ER luminal protein receptor 2a [Nicotiana benthamiana] Length = 215 Score = 68.2 bits (165), Expect(2) = 1e-11 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 264 LSCVSGLVQTAMYADFFYYFFISWKNNVKLQLPA 163 +SC SGLVQTA+YADFFYY+FISWKNN KLQLPA Sbjct: 182 ISCFSGLVQTALYADFFYYYFISWKNNAKLQLPA 215 Score = 26.2 bits (56), Expect(2) = 1e-11 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = -1 Query: 299 IYRYITEPHFTLYLA 255 IYRY+TEP FT +++ Sbjct: 169 IYRYLTEPRFTRWIS 183 >gb|ACD56623.1| ERD2-like protein [Gossypium raimondii] Length = 215 Score = 67.8 bits (164), Expect(2) = 1e-11 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -3 Query: 264 LSCVSGLVQTAMYADFFYYFFISWKNNVKLQLPA 163 ++CVSG+VQTA+YADFFYY+F+SWKNN KLQLPA Sbjct: 182 IACVSGIVQTALYADFFYYYFVSWKNNAKLQLPA 215 Score = 26.6 bits (57), Expect(2) = 1e-11 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -1 Query: 299 IYRYITEPHFTLYLA 255 IYRY TE HFT ++A Sbjct: 169 IYRYFTEQHFTRWIA 183 >ref|XP_002522261.1| er lumen protein retaining receptor, putative [Ricinus communis] gi|223538514|gb|EEF40119.1| er lumen protein retaining receptor, putative [Ricinus communis] Length = 215 Score = 69.7 bits (169), Expect(2) = 1e-11 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -3 Query: 264 LSCVSGLVQTAMYADFFYYFFISWKNNVKLQLPA 163 +SC+SGLVQTA+YADFFYY+FISWKNN KLQLPA Sbjct: 182 ISCISGLVQTALYADFFYYYFISWKNNAKLQLPA 215 Score = 24.3 bits (51), Expect(2) = 1e-11 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 299 IYRYITEPHFTLYLASL 249 IYRY TE HF+ +++ + Sbjct: 169 IYRYFTETHFSRWISCI 185 >ref|XP_002267990.1| PREDICTED: ER lumen protein retaining receptor [Vitis vinifera] gi|297740541|emb|CBI30723.3| unnamed protein product [Vitis vinifera] Length = 215 Score = 67.8 bits (164), Expect(2) = 2e-11 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -3 Query: 264 LSCVSGLVQTAMYADFFYYFFISWKNNVKLQLPA 163 ++C+SGLVQTA+YADFFYY+FISWKNN KLQLPA Sbjct: 182 IACISGLVQTALYADFFYYYFISWKNNSKLQLPA 215 Score = 25.4 bits (54), Expect(2) = 2e-11 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 299 IYRYITEPHFTLYLASL 249 IYRY TE HF+ ++A + Sbjct: 169 IYRYFTEQHFSRWIACI 185