BLASTX nr result
ID: Bupleurum21_contig00022802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00022802 (313 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI36940.3| unnamed protein product [Vitis vinifera] 124 1e-26 ref|XP_002275880.1| PREDICTED: uncharacterized protein LOC100260... 124 1e-26 ref|XP_002320978.1| predicted protein [Populus trichocarpa] gi|2... 122 2e-26 ref|XP_002515295.1| protein binding protein, putative [Ricinus c... 120 1e-25 ref|XP_002301508.1| predicted protein [Populus trichocarpa] gi|2... 119 2e-25 >emb|CBI36940.3| unnamed protein product [Vitis vinifera] Length = 221 Score = 124 bits (310), Expect = 1e-26 Identities = 55/70 (78%), Positives = 60/70 (85%) Frame = +2 Query: 104 VVLFVDELESEIASGIPFCRICHEIEFESCKKLEAPCYCSGTVKFAHRDCIQRWCDEKGN 283 VVLFVD+ E + S +P CRICHE EFESCK LEAPC CSGTVKFAHRDCIQRWC+EKGN Sbjct: 4 VVLFVDDFE--LNSAVPHCRICHEAEFESCKTLEAPCACSGTVKFAHRDCIQRWCNEKGN 61 Query: 284 TTCEICLQTF 313 TTCEICLQ + Sbjct: 62 TTCEICLQEY 71 >ref|XP_002275880.1| PREDICTED: uncharacterized protein LOC100260678 [Vitis vinifera] Length = 220 Score = 124 bits (310), Expect = 1e-26 Identities = 55/70 (78%), Positives = 60/70 (85%) Frame = +2 Query: 104 VVLFVDELESEIASGIPFCRICHEIEFESCKKLEAPCYCSGTVKFAHRDCIQRWCDEKGN 283 VVLFVD+ E + S +P CRICHE EFESCK LEAPC CSGTVKFAHRDCIQRWC+EKGN Sbjct: 4 VVLFVDDFE--LNSAVPHCRICHEAEFESCKTLEAPCACSGTVKFAHRDCIQRWCNEKGN 61 Query: 284 TTCEICLQTF 313 TTCEICLQ + Sbjct: 62 TTCEICLQEY 71 >ref|XP_002320978.1| predicted protein [Populus trichocarpa] gi|222861751|gb|EEE99293.1| predicted protein [Populus trichocarpa] Length = 166 Score = 122 bits (307), Expect = 2e-26 Identities = 54/70 (77%), Positives = 60/70 (85%) Frame = +2 Query: 104 VVLFVDELESEIASGIPFCRICHEIEFESCKKLEAPCYCSGTVKFAHRDCIQRWCDEKGN 283 +VL VD+L++ A IP CRICHE EFESCK LEAPC CSGTVKFAHRDCIQRWC+EKGN Sbjct: 4 IVLLVDDLQTSCA--IPHCRICHEAEFESCKSLEAPCACSGTVKFAHRDCIQRWCNEKGN 61 Query: 284 TTCEICLQTF 313 TTCEICLQ + Sbjct: 62 TTCEICLQNY 71 >ref|XP_002515295.1| protein binding protein, putative [Ricinus communis] gi|223545775|gb|EEF47279.1| protein binding protein, putative [Ricinus communis] Length = 213 Score = 120 bits (301), Expect = 1e-25 Identities = 53/70 (75%), Positives = 60/70 (85%) Frame = +2 Query: 104 VVLFVDELESEIASGIPFCRICHEIEFESCKKLEAPCYCSGTVKFAHRDCIQRWCDEKGN 283 VVL +DEL++ A + CRICHE EFESCK LEAPC CSGTVKFAHRDCIQRWC+EKGN Sbjct: 4 VVLLIDELQTSCA--VSHCRICHEAEFESCKTLEAPCACSGTVKFAHRDCIQRWCNEKGN 61 Query: 284 TTCEICLQTF 313 TTCEICLQ++ Sbjct: 62 TTCEICLQSY 71 >ref|XP_002301508.1| predicted protein [Populus trichocarpa] gi|222843234|gb|EEE80781.1| predicted protein [Populus trichocarpa] Length = 114 Score = 119 bits (299), Expect = 2e-25 Identities = 53/70 (75%), Positives = 58/70 (82%) Frame = +2 Query: 104 VVLFVDELESEIASGIPFCRICHEIEFESCKKLEAPCYCSGTVKFAHRDCIQRWCDEKGN 283 V LFVD+L + A IP CRICHE EFESCK LEAPC CSGTVKFAHR+CIQRWC+EKGN Sbjct: 4 VALFVDDLRTSCA--IPHCRICHEAEFESCKSLEAPCACSGTVKFAHRECIQRWCNEKGN 61 Query: 284 TTCEICLQTF 313 T CEICLQ + Sbjct: 62 TNCEICLQNY 71