BLASTX nr result
ID: Bupleurum21_contig00022721
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00022721 (281 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002328475.1| predicted protein [Populus trichocarpa] gi|2... 71 1e-10 ref|XP_002309894.1| predicted protein [Populus trichocarpa] gi|2... 66 3e-09 ref|XP_002509751.1| protein binding protein, putative [Ricinus c... 63 2e-08 ref|XP_002517233.1| ankyrin repeat-containing protein, putative ... 62 4e-08 ref|XP_002873163.1| predicted protein [Arabidopsis lyrata subsp.... 62 5e-08 >ref|XP_002328475.1| predicted protein [Populus trichocarpa] gi|222838190|gb|EEE76555.1| predicted protein [Populus trichocarpa] Length = 543 Score = 70.9 bits (172), Expect = 1e-10 Identities = 35/63 (55%), Positives = 43/63 (68%) Frame = +1 Query: 1 LSISIAATMVAFSSTLALVLRDKIPWIAAPITLLAVIPVFFFLSWQYPLLVELFRSIYGR 180 L SIA M+ F TL ++LRD+ PWI+ PI LLA +PV F Q+PLLVE+F S YG Sbjct: 469 LFFSIATMMITFGITLFMMLRDRFPWISFPIILLASLPVTLFALLQFPLLVEIFFSTYGP 528 Query: 181 GIF 189 GIF Sbjct: 529 GIF 531 >ref|XP_002309894.1| predicted protein [Populus trichocarpa] gi|222852797|gb|EEE90344.1| predicted protein [Populus trichocarpa] Length = 548 Score = 66.2 bits (160), Expect = 3e-09 Identities = 32/63 (50%), Positives = 42/63 (66%) Frame = +1 Query: 1 LSISIAATMVAFSSTLALVLRDKIPWIAAPITLLAVIPVFFFLSWQYPLLVELFRSIYGR 180 L SIA M+ F TL ++LR++ W++ PI LLA +PV F Q+PLLVE+F S YG Sbjct: 477 LFFSIATMMITFGITLVMMLRERFHWVSFPIILLASLPVTLFALLQFPLLVEIFFSTYGP 536 Query: 181 GIF 189 GIF Sbjct: 537 GIF 539 >ref|XP_002509751.1| protein binding protein, putative [Ricinus communis] gi|223549650|gb|EEF51138.1| protein binding protein, putative [Ricinus communis] Length = 325 Score = 63.2 bits (152), Expect = 2e-08 Identities = 35/63 (55%), Positives = 45/63 (71%) Frame = +1 Query: 1 LSISIAATMVAFSSTLALVLRDKIPWIAAPITLLAVIPVFFFLSWQYPLLVELFRSIYGR 180 L +SIAA MVAF STL ++LR ++ I P+ LLA IPV F+ Q+PLLV++F S YG Sbjct: 256 LFVSIAAMMVAFCSTLIIMLRGQLNLIM-PLVLLASIPVTLFVLQQFPLLVDIFASTYGP 314 Query: 181 GIF 189 GIF Sbjct: 315 GIF 317 >ref|XP_002517233.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223543604|gb|EEF45133.1| ankyrin repeat-containing protein, putative [Ricinus communis] Length = 580 Score = 62.4 bits (150), Expect = 4e-08 Identities = 31/63 (49%), Positives = 39/63 (61%) Frame = +1 Query: 1 LSISIAATMVAFSSTLALVLRDKIPWIAAPITLLAVIPVFFFLSWQYPLLVELFRSIYGR 180 L SIA M+ F L LR+++ W+ PI LLA +PV F Q+PLLVE+F S YG Sbjct: 509 LFFSIATMMITFGVALFTFLRERVSWVLFPIILLASLPVTLFALLQFPLLVEIFFSTYGL 568 Query: 181 GIF 189 GIF Sbjct: 569 GIF 571 >ref|XP_002873163.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297319000|gb|EFH49422.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 649 Score = 62.0 bits (149), Expect = 5e-08 Identities = 32/63 (50%), Positives = 40/63 (63%) Frame = +1 Query: 1 LSISIAATMVAFSSTLALVLRDKIPWIAAPITLLAVIPVFFFLSWQYPLLVELFRSIYGR 180 L +SI A ++AFSS L + DK WI AP LLA +P F+ QYPLL E+ S YG+ Sbjct: 579 LFVSIGAMLIAFSSAL-FTMMDKEKWIVAPTILLACLPALLFVLLQYPLLKEMIFSTYGK 637 Query: 181 GIF 189 GIF Sbjct: 638 GIF 640