BLASTX nr result
ID: Bupleurum21_contig00022232
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00022232 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004171470.1| PREDICTED: zinc finger protein NUTCRACKER-li... 184 7e-45 ref|XP_004146996.1| PREDICTED: zinc finger protein NUTCRACKER-li... 184 7e-45 ref|XP_002274683.2| PREDICTED: zinc finger protein NUTCRACKER-li... 182 2e-44 emb|CBI25044.3| unnamed protein product [Vitis vinifera] 182 2e-44 ref|XP_002520944.1| nucleic acid binding protein, putative [Rici... 181 6e-44 >ref|XP_004171470.1| PREDICTED: zinc finger protein NUTCRACKER-like, partial [Cucumis sativus] Length = 486 Score = 184 bits (467), Expect = 7e-45 Identities = 81/87 (93%), Positives = 84/87 (96%) Frame = -3 Query: 263 TNRFVCEICKKGFQRDQNLQLHRRGHNLPWKLKQRNDKDVVIKKKAYVCPEPSCVHHHPS 84 TNRFVCEIC KGFQRDQNLQLHRRGHNLPWKLKQRN+K+V KKKAYVCPEPSCVHHHPS Sbjct: 76 TNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRNNKEV--KKKAYVCPEPSCVHHHPS 133 Query: 83 RALGDLTGIKKHFCRKHGEKKWKCDKC 3 RALGDLTGIKKH+CRKHGEKKWKCDKC Sbjct: 134 RALGDLTGIKKHYCRKHGEKKWKCDKC 160 >ref|XP_004146996.1| PREDICTED: zinc finger protein NUTCRACKER-like [Cucumis sativus] Length = 520 Score = 184 bits (467), Expect = 7e-45 Identities = 81/87 (93%), Positives = 84/87 (96%) Frame = -3 Query: 263 TNRFVCEICKKGFQRDQNLQLHRRGHNLPWKLKQRNDKDVVIKKKAYVCPEPSCVHHHPS 84 TNRFVCEIC KGFQRDQNLQLHRRGHNLPWKLKQRN+K+V KKKAYVCPEPSCVHHHPS Sbjct: 76 TNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRNNKEV--KKKAYVCPEPSCVHHHPS 133 Query: 83 RALGDLTGIKKHFCRKHGEKKWKCDKC 3 RALGDLTGIKKH+CRKHGEKKWKCDKC Sbjct: 134 RALGDLTGIKKHYCRKHGEKKWKCDKC 160 >ref|XP_002274683.2| PREDICTED: zinc finger protein NUTCRACKER-like [Vitis vinifera] Length = 456 Score = 182 bits (462), Expect = 2e-44 Identities = 80/87 (91%), Positives = 83/87 (95%) Frame = -3 Query: 263 TNRFVCEICKKGFQRDQNLQLHRRGHNLPWKLKQRNDKDVVIKKKAYVCPEPSCVHHHPS 84 TNRFVCEIC KGFQRDQNLQLHRRGHNLPWKLKQRN K+ IKKKAYVCPEP+CVHHHPS Sbjct: 74 TNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRNSKE--IKKKAYVCPEPTCVHHHPS 131 Query: 83 RALGDLTGIKKHFCRKHGEKKWKCDKC 3 RALGDLTGIKKHFCRKHGEKKWKC+KC Sbjct: 132 RALGDLTGIKKHFCRKHGEKKWKCEKC 158 >emb|CBI25044.3| unnamed protein product [Vitis vinifera] Length = 399 Score = 182 bits (462), Expect = 2e-44 Identities = 80/87 (91%), Positives = 83/87 (95%) Frame = -3 Query: 263 TNRFVCEICKKGFQRDQNLQLHRRGHNLPWKLKQRNDKDVVIKKKAYVCPEPSCVHHHPS 84 TNRFVCEIC KGFQRDQNLQLHRRGHNLPWKLKQRN K+ IKKKAYVCPEP+CVHHHPS Sbjct: 69 TNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRNSKE--IKKKAYVCPEPTCVHHHPS 126 Query: 83 RALGDLTGIKKHFCRKHGEKKWKCDKC 3 RALGDLTGIKKHFCRKHGEKKWKC+KC Sbjct: 127 RALGDLTGIKKHFCRKHGEKKWKCEKC 153 >ref|XP_002520944.1| nucleic acid binding protein, putative [Ricinus communis] gi|223539781|gb|EEF41361.1| nucleic acid binding protein, putative [Ricinus communis] Length = 466 Score = 181 bits (459), Expect = 6e-44 Identities = 79/87 (90%), Positives = 83/87 (95%) Frame = -3 Query: 263 TNRFVCEICKKGFQRDQNLQLHRRGHNLPWKLKQRNDKDVVIKKKAYVCPEPSCVHHHPS 84 TNRFVCEIC KGFQRDQNLQLHRRGHNLPWKLKQRN K+ IKK+AYVCPEPSCVHHHPS Sbjct: 75 TNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRNSKE--IKKRAYVCPEPSCVHHHPS 132 Query: 83 RALGDLTGIKKHFCRKHGEKKWKCDKC 3 RALGDLTGIKKH+CRKHGEKKWKC+KC Sbjct: 133 RALGDLTGIKKHYCRKHGEKKWKCEKC 159