BLASTX nr result
ID: Bupleurum21_contig00022084
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00022084 (298 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002322394.1| predicted protein [Populus trichocarpa] gi|2... 61 1e-07 ref|XP_002318291.1| predicted protein [Populus trichocarpa] gi|2... 60 1e-07 ref|XP_003637222.1| Coatomer subunit delta [Medicago truncatula]... 58 7e-07 ref|XP_002276172.2| PREDICTED: coatomer subunit delta [Vitis vin... 57 1e-06 emb|CBI27189.3| unnamed protein product [Vitis vinifera] 57 1e-06 >ref|XP_002322394.1| predicted protein [Populus trichocarpa] gi|222869390|gb|EEF06521.1| predicted protein [Populus trichocarpa] Length = 529 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 298 DLKVLNILPLKGGAPPKFSQRTQLSTENYQVI 203 +LKV NILPLKGGAPPKFSQRTQL TENYQV+ Sbjct: 498 ELKVANILPLKGGAPPKFSQRTQLITENYQVV 529 >ref|XP_002318291.1| predicted protein [Populus trichocarpa] gi|222858964|gb|EEE96511.1| predicted protein [Populus trichocarpa] Length = 529 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 298 DLKVLNILPLKGGAPPKFSQRTQLSTENYQV 206 +LKV+NILPLKGGAPPKFSQRTQL TENYQV Sbjct: 498 ELKVVNILPLKGGAPPKFSQRTQLITENYQV 528 >ref|XP_003637222.1| Coatomer subunit delta [Medicago truncatula] gi|355503157|gb|AES84360.1| Coatomer subunit delta [Medicago truncatula] Length = 530 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 298 DLKVLNILPLKGGAPPKFSQRTQLSTENYQVI 203 DLKV NI+PLKGG PPKF+QRTQL TENYQV+ Sbjct: 499 DLKVTNIIPLKGGNPPKFAQRTQLITENYQVV 530 >ref|XP_002276172.2| PREDICTED: coatomer subunit delta [Vitis vinifera] Length = 508 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 298 DLKVLNILPLKGGAPPKFSQRTQLSTENYQVI 203 DLKV+N+LPL+GG PPKFSQRT L TENYQV+ Sbjct: 477 DLKVVNVLPLRGGPPPKFSQRTTLITENYQVV 508 >emb|CBI27189.3| unnamed protein product [Vitis vinifera] Length = 561 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 298 DLKVLNILPLKGGAPPKFSQRTQLSTENYQVI 203 DLKV+N+LPL+GG PPKFSQRT L TENYQV+ Sbjct: 530 DLKVVNVLPLRGGPPPKFSQRTTLITENYQVV 561