BLASTX nr result
ID: Bupleurum21_contig00021451
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00021451 (615 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306347.1| predicted protein [Populus trichocarpa] gi|2... 67 3e-09 ref|XP_002528666.1| Protein CPR-5, putative [Ricinus communis] g... 62 1e-07 ref|XP_002280314.1| PREDICTED: protein CPR-5-like [Vitis vinifera] 59 5e-07 ref|XP_004160162.1| PREDICTED: protein CPR-5-like [Cucumis sativus] 59 7e-07 ref|XP_004143575.1| PREDICTED: protein CPR-5-like [Cucumis sativus] 59 7e-07 >ref|XP_002306347.1| predicted protein [Populus trichocarpa] gi|222855796|gb|EEE93343.1| predicted protein [Populus trichocarpa] Length = 192 Score = 67.0 bits (162), Expect = 3e-09 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -1 Query: 612 ICPLWIRRCLFYSTTLLVLPLMCGFMPFAGPAEWINHFCSL 490 I P W+R+ LFY+T++L LPL CG +PFAGP EW NHFC L Sbjct: 141 IFPYWLRKLLFYATSVLFLPLCCGLLPFAGPGEWTNHFCLL 181 >ref|XP_002528666.1| Protein CPR-5, putative [Ricinus communis] gi|223531889|gb|EEF33705.1| Protein CPR-5, putative [Ricinus communis] Length = 547 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/38 (63%), Positives = 28/38 (73%) Frame = -1 Query: 612 ICPLWIRRCLFYSTTLLVLPLMCGFMPFAGPAEWINHF 499 +CP W RR LFY+ LLVLPL CG +PFA P EW +HF Sbjct: 497 LCPYWFRRILFYAALLLVLPLCCGLLPFADPGEWKDHF 534 >ref|XP_002280314.1| PREDICTED: protein CPR-5-like [Vitis vinifera] Length = 587 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/42 (59%), Positives = 29/42 (69%) Frame = -1 Query: 606 PLWIRRCLFYSTTLLVLPLMCGFMPFAGPAEWINHFCSLVLD 481 P WIRR LFY+ LL LPL+CG MPFA P EW + F L+ D Sbjct: 539 PYWIRRTLFYAAILLFLPLLCGLMPFASPGEWKDRFLLLLAD 580 >ref|XP_004160162.1| PREDICTED: protein CPR-5-like [Cucumis sativus] Length = 562 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/42 (54%), Positives = 31/42 (73%) Frame = -1 Query: 612 ICPLWIRRCLFYSTTLLVLPLMCGFMPFAGPAEWINHFCSLV 487 I P W RR +FY+ L+ +PL+CG +PFAG +EW +HFC LV Sbjct: 512 ILPYWFRRVVFYTLLLVFMPLLCGLIPFAGISEWKDHFCLLV 553 >ref|XP_004143575.1| PREDICTED: protein CPR-5-like [Cucumis sativus] Length = 493 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/42 (54%), Positives = 31/42 (73%) Frame = -1 Query: 612 ICPLWIRRCLFYSTTLLVLPLMCGFMPFAGPAEWINHFCSLV 487 I P W RR +FY+ L+ +PL+CG +PFAG +EW +HFC LV Sbjct: 443 ILPYWFRRVVFYTLLLVFMPLLCGLIPFAGISEWKDHFCLLV 484