BLASTX nr result
ID: Bupleurum21_contig00021276
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00021276 (585 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265458.1| PREDICTED: diphthamide biosynthesis protein ... 71 2e-10 emb|CBI31120.3| unnamed protein product [Vitis vinifera] 69 6e-10 ref|XP_002529006.1| Diphthamide biosynthesis protein, putative [... 68 1e-09 ref|XP_003610873.1| Diphthamide biosynthesis protein [Medicago t... 63 4e-08 ref|XP_003540663.1| PREDICTED: diphthamide biosynthesis protein ... 62 7e-08 >ref|XP_002265458.1| PREDICTED: diphthamide biosynthesis protein 1-like [Vitis vinifera] Length = 461 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/46 (69%), Positives = 35/46 (76%) Frame = +1 Query: 7 KDEEKTVVDYPMDYYAQDGGEWNSSYLKKQTRPSRRIIVSGNGNGS 144 KD+ DYPMDYYAQDGGEWNSSY KK TRPSRR + S GNG+ Sbjct: 414 KDKVDVSQDYPMDYYAQDGGEWNSSYAKKSTRPSRRNVSSCTGNGA 459 >emb|CBI31120.3| unnamed protein product [Vitis vinifera] Length = 312 Score = 68.9 bits (167), Expect = 6e-10 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = +1 Query: 31 DYPMDYYAQDGGEWNSSYLKKQTRPSRRIIVSGNGNGS 144 DYPMDYYAQDGGEWNSSY KK TRPSRR + S GNG+ Sbjct: 273 DYPMDYYAQDGGEWNSSYAKKSTRPSRRNVSSCTGNGA 310 >ref|XP_002529006.1| Diphthamide biosynthesis protein, putative [Ricinus communis] gi|223531546|gb|EEF33376.1| Diphthamide biosynthesis protein, putative [Ricinus communis] Length = 434 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = +1 Query: 31 DYPMDYYAQDGGEWNSSYLKKQTRPSRRIIVSGNGNGSTL 150 DYPMDYYAQDGGEWNS+Y+KK TRP RR +VS G G+ L Sbjct: 395 DYPMDYYAQDGGEWNSAYVKKATRPVRRNVVSSGGYGAAL 434 >ref|XP_003610873.1| Diphthamide biosynthesis protein [Medicago truncatula] gi|355512208|gb|AES93831.1| Diphthamide biosynthesis protein [Medicago truncatula] Length = 575 Score = 62.8 bits (151), Expect = 4e-08 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 31 DYPMDYYAQDGGEWNSSYLKKQTRPSRRIIVSGNGN 138 DYPMDYYAQDGGEWNSSY+KK +RP+R+I V+ N Sbjct: 423 DYPMDYYAQDGGEWNSSYMKKPSRPARKISVTSVAN 458 >ref|XP_003540663.1| PREDICTED: diphthamide biosynthesis protein 1-like [Glycine max] Length = 459 Score = 62.0 bits (149), Expect = 7e-08 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +1 Query: 31 DYPMDYYAQDGGEWNSSYLKKQTRPSRRIIVSGN 132 DYPMDYYAQDGGEWNSSY+KK TRP+RR + N Sbjct: 420 DYPMDYYAQDGGEWNSSYVKKSTRPARRSPLPNN 453