BLASTX nr result
ID: Bupleurum21_contig00021272
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00021272 (348 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532411.1| catalytic, putative [Ricinus communis] gi|22... 75 3e-14 ref|XP_003574568.1| PREDICTED: uncharacterized protein LOC100842... 74 4e-14 dbj|BAK06789.1| predicted protein [Hordeum vulgare subsp. vulgare] 74 4e-14 gb|EEC83655.1| hypothetical protein OsI_29416 [Oryza sativa Indi... 74 7e-14 gb|EEE68785.1| hypothetical protein OsJ_27509 [Oryza sativa Japo... 74 7e-14 >ref|XP_002532411.1| catalytic, putative [Ricinus communis] gi|223527885|gb|EEF29975.1| catalytic, putative [Ricinus communis] Length = 379 Score = 74.7 bits (182), Expect(2) = 3e-14 Identities = 38/59 (64%), Positives = 44/59 (74%) Frame = +2 Query: 86 QLSFFCGLPFLEKQASQTVHLIAGRTGKHLFLTE*LTKMATVRPLLLRLVYDLDDIKFI 262 QL F CGLPFLE++ASQT HLI GRTGKHLFLT+ PLLL++V D DD+KFI Sbjct: 234 QLPFLCGLPFLERRASQTAHLIVGRTGKHLFLTD---NDGGKPPLLLQMVNDSDDLKFI 289 Score = 28.1 bits (61), Expect(2) = 3e-14 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = +1 Query: 301 LGWRTLSI*RQHELSK 348 +GWRT SI RQHEL K Sbjct: 310 VGWRTSSIRRQHELPK 325 >ref|XP_003574568.1| PREDICTED: uncharacterized protein LOC100842570 [Brachypodium distachyon] Length = 431 Score = 74.3 bits (181), Expect(2) = 4e-14 Identities = 38/58 (65%), Positives = 44/58 (75%) Frame = +2 Query: 86 QLSFFCGLPFLEKQASQTVHLIAGRTGKHLFLTE*LTKMATVRPLLLRLVYDLDDIKF 259 QL F CGLPFLE++AS+T HLI GRTGKHLFLT+ RPLLL++V D DDIKF Sbjct: 248 QLPFLCGLPFLERRASETAHLIVGRTGKHLFLTD---SDDGRRPLLLQMVDDCDDIKF 302 Score = 28.1 bits (61), Expect(2) = 4e-14 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = +1 Query: 301 LGWRTLSI*RQHELSK 348 +GWRT SI RQHEL K Sbjct: 324 VGWRTSSIRRQHELPK 339 >dbj|BAK06789.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 269 Score = 74.3 bits (181), Expect(2) = 4e-14 Identities = 38/58 (65%), Positives = 44/58 (75%) Frame = +2 Query: 86 QLSFFCGLPFLEKQASQTVHLIAGRTGKHLFLTE*LTKMATVRPLLLRLVYDLDDIKF 259 QL F CGLPFLE++AS+T HLI GRTGKHLFLT+ RPLLL++V D DDIKF Sbjct: 86 QLPFLCGLPFLERRASETAHLIVGRTGKHLFLTD---NDDGRRPLLLQMVQDHDDIKF 140 Score = 28.1 bits (61), Expect(2) = 4e-14 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = +1 Query: 301 LGWRTLSI*RQHELSK 348 +GWRT SI RQHEL K Sbjct: 162 VGWRTSSIRRQHELPK 177 >gb|EEC83655.1| hypothetical protein OsI_29416 [Oryza sativa Indica Group] Length = 946 Score = 73.6 bits (179), Expect(2) = 7e-14 Identities = 37/58 (63%), Positives = 44/58 (75%) Frame = +2 Query: 86 QLSFFCGLPFLEKQASQTVHLIAGRTGKHLFLTE*LTKMATVRPLLLRLVYDLDDIKF 259 QL F CGLPFLE++AS+T HL+ GRTGKHLFLT+ RPLLL++V D DDIKF Sbjct: 230 QLPFLCGLPFLERRASETAHLLVGRTGKHLFLTD---NDDGRRPLLLQMVDDCDDIKF 284 Score = 28.1 bits (61), Expect(2) = 7e-14 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = +1 Query: 301 LGWRTLSI*RQHELSK 348 +GWRT SI RQHEL K Sbjct: 306 VGWRTSSIRRQHELPK 321 >gb|EEE68785.1| hypothetical protein OsJ_27509 [Oryza sativa Japonica Group] Length = 429 Score = 73.6 bits (179), Expect(2) = 7e-14 Identities = 37/58 (63%), Positives = 44/58 (75%) Frame = +2 Query: 86 QLSFFCGLPFLEKQASQTVHLIAGRTGKHLFLTE*LTKMATVRPLLLRLVYDLDDIKF 259 QL F CGLPFLE++AS+T HL+ GRTGKHLFLT+ RPLLL++V D DDIKF Sbjct: 230 QLPFLCGLPFLERRASETAHLLVGRTGKHLFLTD---NDDGRRPLLLQMVDDCDDIKF 284 Score = 28.1 bits (61), Expect(2) = 7e-14 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = +1 Query: 301 LGWRTLSI*RQHELSK 348 +GWRT SI RQHEL K Sbjct: 306 VGWRTSSIRRQHELPK 321