BLASTX nr result
ID: Bupleurum21_contig00021237
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00021237 (318 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002309288.1| predicted protein [Populus trichocarpa] gi|2... 70 2e-10 ref|XP_003554226.1| PREDICTED: disease resistance response prote... 69 3e-10 ref|XP_002531174.1| Disease resistance response protein, putativ... 67 1e-09 ref|XP_002280711.1| PREDICTED: disease resistance response prote... 67 2e-09 emb|CAN69110.1| hypothetical protein VITISV_006598 [Vitis vinifera] 67 2e-09 >ref|XP_002309288.1| predicted protein [Populus trichocarpa] gi|222855264|gb|EEE92811.1| predicted protein [Populus trichocarpa] Length = 182 Score = 69.7 bits (169), Expect = 2e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -1 Query: 318 LFRFARGYAQAKTHFYDFKTGDAVVEYNVYVFHY 217 LFRFARGYAQAKTH DFKTGDA+VEYNVYVFHY Sbjct: 149 LFRFARGYAQAKTHDLDFKTGDAIVEYNVYVFHY 182 >ref|XP_003554226.1| PREDICTED: disease resistance response protein 206-like [Glycine max] Length = 191 Score = 69.3 bits (168), Expect = 3e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -1 Query: 315 FRFARGYAQAKTHFYDFKTGDAVVEYNVYVFHY 217 FRFARGYAQAKTH +D+KTGDAVVEYNVYVFHY Sbjct: 159 FRFARGYAQAKTHTFDYKTGDAVVEYNVYVFHY 191 >ref|XP_002531174.1| Disease resistance response protein, putative [Ricinus communis] gi|223529244|gb|EEF31217.1| Disease resistance response protein, putative [Ricinus communis] Length = 196 Score = 67.4 bits (163), Expect = 1e-09 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -1 Query: 318 LFRFARGYAQAKTHFYDFKTGDAVVEYNVYVFHY 217 LFRFARGYAQAKTH D KTGDA+VEYNVYVFHY Sbjct: 163 LFRFARGYAQAKTHELDLKTGDAIVEYNVYVFHY 196 >ref|XP_002280711.1| PREDICTED: disease resistance response protein 206 [Vitis vinifera] Length = 192 Score = 66.6 bits (161), Expect = 2e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 318 LFRFARGYAQAKTHFYDFKTGDAVVEYNVYVFHY 217 LFRFARGYAQA+TH ++ KTGDAVVEYNVYVFHY Sbjct: 159 LFRFARGYAQARTHTFNLKTGDAVVEYNVYVFHY 192 >emb|CAN69110.1| hypothetical protein VITISV_006598 [Vitis vinifera] Length = 154 Score = 66.6 bits (161), Expect = 2e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 318 LFRFARGYAQAKTHFYDFKTGDAVVEYNVYVFHY 217 LFRFARGYAQA+TH ++ KTGDAVVEYNVYVFHY Sbjct: 121 LFRFARGYAQARTHTFNLKTGDAVVEYNVYVFHY 154