BLASTX nr result
ID: Bupleurum21_contig00021221
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00021221 (342 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003554628.1| PREDICTED: probable protein phosphatase 2C 7... 86 4e-15 ref|XP_003521676.1| PREDICTED: probable protein phosphatase 2C 7... 86 4e-15 ref|XP_003591185.1| hypothetical protein MTR_1g083690 [Medicago ... 83 2e-14 ref|NP_001242626.1| uncharacterized protein LOC100794039 [Glycin... 83 2e-14 ref|XP_002512471.1| protein phosphatase 2c, putative [Ricinus co... 83 2e-14 >ref|XP_003554628.1| PREDICTED: probable protein phosphatase 2C 73-like [Glycine max] Length = 369 Score = 85.5 bits (210), Expect = 4e-15 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -3 Query: 127 TSDDGSLVPVQLTLDFKPNIPQEAERIVQCNGRVFCLDDEPG 2 TSDDGSLVPVQLT+DFKPN+PQEAERI+QC GRVFCL+DEPG Sbjct: 204 TSDDGSLVPVQLTIDFKPNLPQEAERIIQCQGRVFCLEDEPG 245 >ref|XP_003521676.1| PREDICTED: probable protein phosphatase 2C 73-like [Glycine max] Length = 371 Score = 85.5 bits (210), Expect = 4e-15 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -3 Query: 127 TSDDGSLVPVQLTLDFKPNIPQEAERIVQCNGRVFCLDDEPG 2 TSDDGSLVPVQLT+DFKPN+PQEAERI+QC GRVFCL+DEPG Sbjct: 205 TSDDGSLVPVQLTIDFKPNLPQEAERIIQCQGRVFCLEDEPG 246 >ref|XP_003591185.1| hypothetical protein MTR_1g083690 [Medicago truncatula] gi|87162555|gb|ABD28350.1| Protein phosphatase 2C-like [Medicago truncatula] gi|355480233|gb|AES61436.1| hypothetical protein MTR_1g083690 [Medicago truncatula] Length = 352 Score = 83.2 bits (204), Expect = 2e-14 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = -3 Query: 127 TSDDGSLVPVQLTLDFKPNIPQEAERIVQCNGRVFCLDDEPG 2 TSDDG+LVPVQLT+DFKPN+PQEAERI+ C GRVFCLDDEPG Sbjct: 201 TSDDGNLVPVQLTIDFKPNLPQEAERILDCQGRVFCLDDEPG 242 >ref|NP_001242626.1| uncharacterized protein LOC100794039 [Glycine max] gi|255647130|gb|ACU24033.1| unknown [Glycine max] Length = 368 Score = 83.2 bits (204), Expect = 2e-14 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -3 Query: 127 TSDDGSLVPVQLTLDFKPNIPQEAERIVQCNGRVFCLDDEPG 2 TSDDGSLVPVQLT+DFKPN+PQEAERI++ NGRVFCLDDEPG Sbjct: 205 TSDDGSLVPVQLTVDFKPNLPQEAERILESNGRVFCLDDEPG 246 >ref|XP_002512471.1| protein phosphatase 2c, putative [Ricinus communis] gi|223548432|gb|EEF49923.1| protein phosphatase 2c, putative [Ricinus communis] Length = 359 Score = 83.2 bits (204), Expect = 2e-14 Identities = 36/42 (85%), Positives = 41/42 (97%) Frame = -3 Query: 127 TSDDGSLVPVQLTLDFKPNIPQEAERIVQCNGRVFCLDDEPG 2 TSDDG+LV VQLT+DFKPN+PQEAERI+QCNGRVFCL+DEPG Sbjct: 203 TSDDGNLVSVQLTIDFKPNLPQEAERIIQCNGRVFCLNDEPG 244