BLASTX nr result
ID: Bupleurum21_contig00021048
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00021048 (342 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003637734.1| ATP-dependent RNA helicase [Medicago truncat... 79 3e-13 ref|XP_002277120.2| PREDICTED: DEAD-box ATP-dependent RNA helica... 76 2e-12 emb|CBI40505.3| unnamed protein product [Vitis vinifera] 76 2e-12 emb|CAN67649.1| hypothetical protein VITISV_005080 [Vitis vinifera] 76 2e-12 ref|XP_003548422.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 76 3e-12 >ref|XP_003637734.1| ATP-dependent RNA helicase [Medicago truncatula] gi|355503669|gb|AES84872.1| ATP-dependent RNA helicase [Medicago truncatula] Length = 290 Score = 79.3 bits (194), Expect = 3e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +3 Query: 3 RLVELANEFSRCMGLDNPPAISKLVLGKMGLRNIPGLRSK 122 RLVELANEFSRCMGLDNPPAI KLVLGKMGL+N+PGLRSK Sbjct: 251 RLVELANEFSRCMGLDNPPAIPKLVLGKMGLKNVPGLRSK 290 >ref|XP_002277120.2| PREDICTED: DEAD-box ATP-dependent RNA helicase 31-like [Vitis vinifera] Length = 751 Score = 76.3 bits (186), Expect = 2e-12 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +3 Query: 3 RLVELANEFSRCMGLDNPPAISKLVLGKMGLRNIPGLRSK 122 RLVELANEFSR MGLDNPPAI KL+LGKMGLRN+PGLRSK Sbjct: 712 RLVELANEFSRTMGLDNPPAIPKLILGKMGLRNVPGLRSK 751 >emb|CBI40505.3| unnamed protein product [Vitis vinifera] Length = 732 Score = 76.3 bits (186), Expect = 2e-12 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +3 Query: 3 RLVELANEFSRCMGLDNPPAISKLVLGKMGLRNIPGLRSK 122 RLVELANEFSR MGLDNPPAI KL+LGKMGLRN+PGLRSK Sbjct: 693 RLVELANEFSRTMGLDNPPAIPKLILGKMGLRNVPGLRSK 732 >emb|CAN67649.1| hypothetical protein VITISV_005080 [Vitis vinifera] Length = 863 Score = 76.3 bits (186), Expect = 2e-12 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +3 Query: 3 RLVELANEFSRCMGLDNPPAISKLVLGKMGLRNIPGLRSK 122 RLVELANEFSR MGLDNPPAI KL+LGKMGLRN+PGLRSK Sbjct: 824 RLVELANEFSRTMGLDNPPAIPKLILGKMGLRNVPGLRSK 863 >ref|XP_003548422.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 31-like [Glycine max] Length = 806 Score = 75.9 bits (185), Expect = 3e-12 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = +3 Query: 3 RLVELANEFSRCMGLDNPPAISKLVLGKMGLRNIPGLRSK 122 RLVELANEFSR MGLDNPPAI KLVLGKMGLRNIPGLR+K Sbjct: 767 RLVELANEFSRSMGLDNPPAIPKLVLGKMGLRNIPGLRAK 806