BLASTX nr result
ID: Bupleurum21_contig00021025
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00021025 (430 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512749.1| phosphatidylinositol-glycan biosynthesis, cl... 56 3e-06 >ref|XP_002512749.1| phosphatidylinositol-glycan biosynthesis, class f, putative [Ricinus communis] gi|223547760|gb|EEF49252.1| phosphatidylinositol-glycan biosynthesis, class f, putative [Ricinus communis] Length = 197 Score = 55.8 bits (133), Expect = 3e-06 Identities = 22/39 (56%), Positives = 32/39 (82%) Frame = -3 Query: 119 VSLKYIFLLHIVCGLGLALAFWVAHNVYSINLVDNPTQT 3 VS+ L+H++CGLGLA++ WVAHN+YS+NLV +P+ T Sbjct: 41 VSILLACLVHLICGLGLAVSLWVAHNLYSVNLVSDPSDT 79