BLASTX nr result
ID: Bupleurum21_contig00020786
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00020786 (298 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003612583.1| Urea active transporter-like protein [Medica... 60 1e-07 >ref|XP_003612583.1| Urea active transporter-like protein [Medicago truncatula] gi|355513918|gb|AES95541.1| Urea active transporter-like protein [Medicago truncatula] Length = 711 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/43 (65%), Positives = 37/43 (86%) Frame = +3 Query: 3 KIDELNTKLNTIMLSVPEAERIYFLEKERTKKKEASDQSSQTI 131 K+DELN KL+TI+ ++PEAER+Y LEKE+TKK EAS+Q S +I Sbjct: 667 KVDELNFKLHTIIQAIPEAERLYLLEKEKTKKLEASEQQSVSI 709