BLASTX nr result
ID: Bupleurum21_contig00019974
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00019974 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_194855.2| sequence-specific DNA binding transcription fac... 68 7e-10 ref|XP_002867306.1| predicted protein [Arabidopsis lyrata subsp.... 68 7e-10 emb|CAA16530.1| hypothetical protein [Arabidopsis thaliana] gi|7... 68 7e-10 ref|XP_002330777.1| predicted protein [Populus trichocarpa] gi|2... 66 3e-09 gb|ABK95479.1| unknown [Populus trichocarpa] 66 3e-09 >ref|NP_194855.2| sequence-specific DNA binding transcription factor [Arabidopsis thaliana] gi|26452367|dbj|BAC43269.1| unknown protein [Arabidopsis thaliana] gi|28950855|gb|AAO63351.1| At4g31270 [Arabidopsis thaliana] gi|332660484|gb|AEE85884.1| sequence-specific DNA binding transcription factor [Arabidopsis thaliana] Length = 294 Score = 68.2 bits (165), Expect = 7e-10 Identities = 25/50 (50%), Positives = 39/50 (78%) Frame = +1 Query: 1 DCLNTFASFQKWKIVVDNCNALGLNRSLNQCKKKWNSLFDDYKKFKIFDA 150 DC N +SFQKW ++ +NCNAL ++R+LNQC++KW+SL DY + K +++ Sbjct: 37 DCSNALSSFQKWTMITENCNALDVSRNLNQCRRKWDSLMSDYNQIKKWES 86 >ref|XP_002867306.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297313142|gb|EFH43565.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 297 Score = 68.2 bits (165), Expect = 7e-10 Identities = 25/50 (50%), Positives = 39/50 (78%) Frame = +1 Query: 1 DCLNTFASFQKWKIVVDNCNALGLNRSLNQCKKKWNSLFDDYKKFKIFDA 150 DC N +SFQKW ++++NCNAL + R+LNQC++KW+SL DY + K +++ Sbjct: 37 DCSNALSSFQKWTMILENCNALDVRRNLNQCRRKWDSLMSDYNQIKQWES 86 >emb|CAA16530.1| hypothetical protein [Arabidopsis thaliana] gi|7270029|emb|CAB79845.1| hypothetical protein [Arabidopsis thaliana] Length = 291 Score = 68.2 bits (165), Expect = 7e-10 Identities = 25/50 (50%), Positives = 39/50 (78%) Frame = +1 Query: 1 DCLNTFASFQKWKIVVDNCNALGLNRSLNQCKKKWNSLFDDYKKFKIFDA 150 DC N +SFQKW ++ +NCNAL ++R+LNQC++KW+SL DY + K +++ Sbjct: 37 DCSNALSSFQKWTMITENCNALDVSRNLNQCRRKWDSLMSDYNQIKKWES 86 >ref|XP_002330777.1| predicted protein [Populus trichocarpa] gi|222872579|gb|EEF09710.1| predicted protein [Populus trichocarpa] Length = 291 Score = 65.9 bits (159), Expect = 3e-09 Identities = 26/51 (50%), Positives = 37/51 (72%) Frame = +1 Query: 1 DCLNTFASFQKWKIVVDNCNALGLNRSLNQCKKKWNSLFDDYKKFKIFDAD 153 DCL +++QKWKI+VDNC L + R+LNQC+ KWNSL ++Y K +D + Sbjct: 33 DCLKALSTYQKWKIIVDNCVVLDVARNLNQCRTKWNSLVNEYNLIKNWDKE 83 >gb|ABK95479.1| unknown [Populus trichocarpa] Length = 459 Score = 65.9 bits (159), Expect = 3e-09 Identities = 26/51 (50%), Positives = 37/51 (72%) Frame = +1 Query: 1 DCLNTFASFQKWKIVVDNCNALGLNRSLNQCKKKWNSLFDDYKKFKIFDAD 153 DCL +++QKWKI+VDNC L + R+LNQC+ KWNSL ++Y K +D + Sbjct: 58 DCLKALSTYQKWKIIVDNCVVLDVARNLNQCRTKWNSLVNEYNLIKNWDKE 108