BLASTX nr result
ID: Bupleurum21_contig00019939
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00019939 (556 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525500.1| conserved hypothetical protein [Ricinus comm... 135 3e-30 ref|XP_002325503.1| predicted protein [Populus trichocarpa] gi|2... 135 3e-30 ref|NP_001238656.1| uncharacterized protein LOC100527353 [Glycin... 135 6e-30 gb|AFK35775.1| unknown [Medicago truncatula] 134 1e-29 ref|XP_003598217.1| Molybdopterin synthase sulfur carrier subuni... 134 1e-29 >ref|XP_002525500.1| conserved hypothetical protein [Ricinus communis] gi|223535179|gb|EEF36858.1| conserved hypothetical protein [Ricinus communis] Length = 103 Score = 135 bits (341), Expect = 3e-30 Identities = 67/88 (76%), Positives = 77/88 (87%) Frame = +3 Query: 24 IEKKSASVGIKVLFFARARDLTGLSEMLLEVSSGSTAQDCLNTLIEKFPKLDEIRGCMVL 203 +E +S+ IKVLFFARARDLTGLSEM LEVSSGST DCLN L+ +FP L+EIR C+VL Sbjct: 16 VESNGSSIKIKVLFFARARDLTGLSEMPLEVSSGSTTNDCLNKLVAQFPSLEEIRRCIVL 75 Query: 204 ALNEEYTSESAIVKDKDELAIIPPISGG 287 ALNEEYT+ESAIV++KDELAIIPPISGG Sbjct: 76 ALNEEYTTESAIVREKDELAIIPPISGG 103 >ref|XP_002325503.1| predicted protein [Populus trichocarpa] gi|222862378|gb|EEE99884.1| predicted protein [Populus trichocarpa] Length = 101 Score = 135 bits (341), Expect = 3e-30 Identities = 66/88 (75%), Positives = 78/88 (88%) Frame = +3 Query: 24 IEKKSASVGIKVLFFARARDLTGLSEMLLEVSSGSTAQDCLNTLIEKFPKLDEIRGCMVL 203 + + +SV IKVLFFARARD+TGL++M LEVSSGST DCLN LI +FP L+EIRGC+VL Sbjct: 14 VGSEGSSVSIKVLFFARARDITGLADMQLEVSSGSTTSDCLNKLIARFPSLEEIRGCIVL 73 Query: 204 ALNEEYTSESAIVKDKDELAIIPPISGG 287 ALNEEYT+E+AIVK+KDELAIIPPISGG Sbjct: 74 ALNEEYTTEAAIVKEKDELAIIPPISGG 101 >ref|NP_001238656.1| uncharacterized protein LOC100527353 [Glycine max] gi|255632153|gb|ACU16429.1| unknown [Glycine max] Length = 102 Score = 135 bits (339), Expect = 6e-30 Identities = 69/87 (79%), Positives = 75/87 (86%) Frame = +3 Query: 27 EKKSASVGIKVLFFARARDLTGLSEMLLEVSSGSTAQDCLNTLIEKFPKLDEIRGCMVLA 206 +K+S+ V IKVLFFARARDLTGLSE+ LEVSSGST DCL L KFP L+EIRGCMVLA Sbjct: 16 KKESSLVKIKVLFFARARDLTGLSELPLEVSSGSTTHDCLKKLFVKFPSLEEIRGCMVLA 75 Query: 207 LNEEYTSESAIVKDKDELAIIPPISGG 287 LNEEYT+ES IVKD DELAIIPPISGG Sbjct: 76 LNEEYTTESTIVKDTDELAIIPPISGG 102 >gb|AFK35775.1| unknown [Medicago truncatula] Length = 103 Score = 134 bits (336), Expect = 1e-29 Identities = 67/87 (77%), Positives = 77/87 (88%) Frame = +3 Query: 27 EKKSASVGIKVLFFARARDLTGLSEMLLEVSSGSTAQDCLNTLIEKFPKLDEIRGCMVLA 206 +++S+ V IKVLFFARARDLTGLSE+ LEVSSGST QDCL L+ +FP L+EI+GCMVLA Sbjct: 17 KRESSLVKIKVLFFARARDLTGLSEVPLEVSSGSTTQDCLKKLLVQFPSLEEIKGCMVLA 76 Query: 207 LNEEYTSESAIVKDKDELAIIPPISGG 287 LNEEYT +S IVKDKDELAIIPPISGG Sbjct: 77 LNEEYTMDSTIVKDKDELAIIPPISGG 103 >ref|XP_003598217.1| Molybdopterin synthase sulfur carrier subunit [Medicago truncatula] gi|355487265|gb|AES68468.1| Molybdopterin synthase sulfur carrier subunit [Medicago truncatula] Length = 102 Score = 134 bits (336), Expect = 1e-29 Identities = 67/87 (77%), Positives = 77/87 (88%) Frame = +3 Query: 27 EKKSASVGIKVLFFARARDLTGLSEMLLEVSSGSTAQDCLNTLIEKFPKLDEIRGCMVLA 206 +++S+ V IKVLFFARARDLTGLSE+ LEVSSGST QDCL L+ +FP L+EI+GCMVLA Sbjct: 16 KRESSLVKIKVLFFARARDLTGLSEVPLEVSSGSTTQDCLKKLLVQFPSLEEIKGCMVLA 75 Query: 207 LNEEYTSESAIVKDKDELAIIPPISGG 287 LNEEYT +S IVKDKDELAIIPPISGG Sbjct: 76 LNEEYTMDSTIVKDKDELAIIPPISGG 102