BLASTX nr result
ID: Bupleurum21_contig00019921
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00019921 (250 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004145292.1| PREDICTED: PGR5-like protein 1A, chloroplast... 69 4e-10 ref|XP_002299869.1| predicted protein [Populus trichocarpa] gi|2... 68 9e-10 ref|XP_002533094.1| conserved hypothetical protein [Ricinus comm... 67 1e-09 ref|XP_003597359.1| PGR5-like protein [Medicago truncatula] gi|3... 66 3e-09 ref|NP_568906.2| uncharacterized protein [Arabidopsis thaliana] ... 65 6e-09 >ref|XP_004145292.1| PREDICTED: PGR5-like protein 1A, chloroplastic-like [Cucumis sativus] gi|449473542|ref|XP_004153911.1| PREDICTED: PGR5-like protein 1A, chloroplastic-like [Cucumis sativus] gi|449515667|ref|XP_004164870.1| PREDICTED: PGR5-like protein 1A, chloroplastic-like [Cucumis sativus] Length = 291 Score = 68.9 bits (167), Expect = 4e-10 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +3 Query: 150 LILDDMFDRVELKLRWYGSKDVVKYPRCSLRKQ 248 LILDDMFDRVELKLRWYGSK VVKYPRCSLR+Q Sbjct: 87 LILDDMFDRVELKLRWYGSKSVVKYPRCSLRRQ 119 >ref|XP_002299869.1| predicted protein [Populus trichocarpa] gi|222847127|gb|EEE84674.1| predicted protein [Populus trichocarpa] Length = 294 Score = 67.8 bits (164), Expect = 9e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +3 Query: 150 LILDDMFDRVELKLRWYGSKDVVKYPRCSLRKQ 248 LI+DDMFDRVELKLRWYGSK VVKYPRCSLR+Q Sbjct: 92 LIVDDMFDRVELKLRWYGSKSVVKYPRCSLRRQ 124 >ref|XP_002533094.1| conserved hypothetical protein [Ricinus communis] gi|223527106|gb|EEF29286.1| conserved hypothetical protein [Ricinus communis] Length = 287 Score = 67.0 bits (162), Expect = 1e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +3 Query: 150 LILDDMFDRVELKLRWYGSKDVVKYPRCSLRKQ 248 LI+DDMFDRVELKLRWYGSK VVKYPRCS+R+Q Sbjct: 85 LIVDDMFDRVELKLRWYGSKSVVKYPRCSIRRQ 117 >ref|XP_003597359.1| PGR5-like protein [Medicago truncatula] gi|355486407|gb|AES67610.1| PGR5-like protein [Medicago truncatula] Length = 286 Score = 65.9 bits (159), Expect = 3e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +3 Query: 150 LILDDMFDRVELKLRWYGSKDVVKYPRCSLRKQ 248 LI+DDMFDRVELKL+WYGSK VVKYPRCS+R+Q Sbjct: 83 LIVDDMFDRVELKLKWYGSKSVVKYPRCSIRRQ 115 >ref|NP_568906.2| uncharacterized protein [Arabidopsis thaliana] gi|332009798|gb|AED97181.1| uncharacterized protein [Arabidopsis thaliana] Length = 301 Score = 65.1 bits (157), Expect = 6e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 150 LILDDMFDRVELKLRWYGSKDVVKYPRCSLRKQ 248 LI+DDMFDRVELKLRWYGSK VVKYPRCSL +Q Sbjct: 91 LIVDDMFDRVELKLRWYGSKSVVKYPRCSLLRQ 123