BLASTX nr result
ID: Bupleurum21_contig00019809
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00019809 (457 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511886.1| protein binding protein, putative [Ricinus c... 70 2e-10 ref|XP_003528846.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 69 4e-10 ref|XP_003548668.1| PREDICTED: uncharacterized protein LOC100804... 67 2e-09 ref|XP_003525385.1| PREDICTED: uncharacterized protein LOC100790... 67 2e-09 gb|ACU24554.1| unknown [Glycine max] 67 2e-09 >ref|XP_002511886.1| protein binding protein, putative [Ricinus communis] gi|223549066|gb|EEF50555.1| protein binding protein, putative [Ricinus communis] Length = 199 Score = 69.7 bits (169), Expect = 2e-10 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 3 EHHFHLACIFEWLERSDTCPVCDQEMVFDPTVN 101 EHHFHL+CI EW+ERSDTCP+CDQEMVFD T N Sbjct: 167 EHHFHLSCILEWMERSDTCPICDQEMVFDHTFN 199 >ref|XP_003528846.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Glycine max] Length = 191 Score = 68.9 bits (167), Expect = 4e-10 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = +3 Query: 3 EHHFHLACIFEWLERSDTCPVCDQEMVFDPTVN 101 EHHFHL+CI EW+ERSD+CP+CDQEM+FD T+N Sbjct: 159 EHHFHLSCILEWMERSDSCPICDQEMIFDQTLN 191 >ref|XP_003548668.1| PREDICTED: uncharacterized protein LOC100804435 [Glycine max] Length = 227 Score = 67.0 bits (162), Expect = 2e-09 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +3 Query: 3 EHHFHLACIFEWLERSDTCPVCDQEMVFDPTVN 101 EHHFHL+CI EW+ERSD+CP+C+QEM+FD T+N Sbjct: 195 EHHFHLSCILEWMERSDSCPICNQEMIFDQTLN 227 >ref|XP_003525385.1| PREDICTED: uncharacterized protein LOC100790079 [Glycine max] Length = 213 Score = 66.6 bits (161), Expect = 2e-09 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +3 Query: 3 EHHFHLACIFEWLERSDTCPVCDQEMVFDPTV 98 +HHFHLACI EW+ERS+TCPVCDQ++VFDP + Sbjct: 181 DHHFHLACILEWMERSETCPVCDQDLVFDPPI 212 >gb|ACU24554.1| unknown [Glycine max] Length = 212 Score = 66.6 bits (161), Expect = 2e-09 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +3 Query: 3 EHHFHLACIFEWLERSDTCPVCDQEMVFDPTV 98 +HHFHLACI EW+ERS+TCPVCDQ++VFDP + Sbjct: 180 DHHFHLACILEWMERSETCPVCDQDLVFDPPI 211