BLASTX nr result
ID: Bupleurum21_contig00019758
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00019758 (284 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN66875.1| hypothetical protein VITISV_009275 [Vitis vinifera] 105 3e-21 dbj|BAD66815.1| orf174 [Beta vulgaris subsp. vulgaris] 102 4e-20 ref|NP_063976.1| orf114a gene product (mitochondrion) [Beta vulg... 58 9e-07 >emb|CAN66875.1| hypothetical protein VITISV_009275 [Vitis vinifera] Length = 142 Score = 105 bits (263), Expect = 3e-21 Identities = 50/53 (94%), Positives = 50/53 (94%) Frame = +3 Query: 3 GSRRPTKARKPGSFRKWIPIRRVHNRMDKLTLTRQFGIQFDIFLGRYREGIGM 161 GSRRPTKARK GSFRKWIPIRRVHNRMDKLTLTRQFGI F IFLGRYREGIGM Sbjct: 90 GSRRPTKARKSGSFRKWIPIRRVHNRMDKLTLTRQFGIHFGIFLGRYREGIGM 142 >dbj|BAD66815.1| orf174 [Beta vulgaris subsp. vulgaris] Length = 174 Score = 102 bits (253), Expect = 4e-20 Identities = 50/54 (92%), Positives = 51/54 (94%), Gaps = 1/54 (1%) Frame = +3 Query: 3 GSRRPTKARKPGSFRKWIPIRRVHNRMDKLTLTRQFG-IQFDIFLGRYREGIGM 161 GSRRPTKARKPGS RKWIPIRRVHNRMDKLTLTRQFG IQF IFLGRYR+GIGM Sbjct: 121 GSRRPTKARKPGSVRKWIPIRRVHNRMDKLTLTRQFGMIQFGIFLGRYRKGIGM 174 >ref|NP_063976.1| orf114a gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435087|ref|YP_004222305.1| hypothetical protein BevumaM_p070 [Beta vulgaris subsp. maritima] gi|346683178|ref|YP_004842110.1| hypothetical protein BemaM_p065 [Beta macrocarpa] gi|9049278|dbj|BAA99288.1| orf114a [Beta vulgaris subsp. vulgaris] gi|317905640|emb|CBJ14041.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439820|emb|CBJ17532.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500096|emb|CBX24914.1| hypothetical protein [Beta macrocarpa] gi|384977899|emb|CBL54123.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 114 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -2 Query: 82 MRLCTLRIGIHFLKDPGFRALVGLRDP 2 MRLCTLRIGIHFL DPGFRALVGLRDP Sbjct: 1 MRLCTLRIGIHFLTDPGFRALVGLRDP 27