BLASTX nr result
ID: Bupleurum21_contig00019741
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00019741 (656 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABX79380.1| actin-depolymerizing factor [Gossypium barbadense] 60 3e-07 gb|ABD66504.1| actin depolymerizing factor 8 [Gossypium hirsutum... 60 3e-07 ref|XP_002311154.1| actin depolymerizing factor 4 [Populus trich... 60 4e-07 ref|NP_190187.1| actin depolymerizing factor 1 [Arabidopsis thal... 59 1e-06 ref|XP_002877449.1| hypothetical protein ARALYDRAFT_484981 [Arab... 59 1e-06 >gb|ABX79380.1| actin-depolymerizing factor [Gossypium barbadense] Length = 139 Score = 60.5 bits (145), Expect = 3e-07 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 406 SSKDRFKRELDRIQVELQATDPNEMDIEVIRSR 504 SSKDRFKRELD IQVELQATDP+EMD++VIRSR Sbjct: 105 SSKDRFKRELDGIQVELQATDPSEMDLDVIRSR 137 >gb|ABD66504.1| actin depolymerizing factor 8 [Gossypium hirsutum] gi|119388970|gb|AAY88048.2| actin depolymerizing factor [Gossypium hirsutum] Length = 139 Score = 60.5 bits (145), Expect = 3e-07 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 406 SSKDRFKRELDRIQVELQATDPNEMDIEVIRSR 504 SSKDRFKRELD IQVELQATDP+EMD++VIRSR Sbjct: 105 SSKDRFKRELDGIQVELQATDPSEMDLDVIRSR 137 >ref|XP_002311154.1| actin depolymerizing factor 4 [Populus trichocarpa] gi|118485497|gb|ABK94603.1| unknown [Populus trichocarpa] gi|222850974|gb|EEE88521.1| actin depolymerizing factor 4 [Populus trichocarpa] Length = 139 Score = 60.1 bits (144), Expect = 4e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +1 Query: 406 SSKDRFKRELDRIQVELQATDPNEMDIEVIRSRNY 510 SSKDRFKRELD IQ+ELQATDP EM ++VIRSR+Y Sbjct: 105 SSKDRFKRELDGIQIELQATDPTEMGLDVIRSRSY 139 >ref|NP_190187.1| actin depolymerizing factor 1 [Arabidopsis thaliana] gi|17366511|sp|Q39250.1|ADF1_ARATH RecName: Full=Actin-depolymerizing factor 1; Short=ADF-1; Short=AtADF1 gi|11513711|pdb|1F7S|A Chain A, Crystal Structure Of Adf1 From Arabidopsis Thaliana gi|1408471|gb|AAB03696.1| actin depolymerizing factor 1 [Arabidopsis thaliana] gi|3851707|gb|AAC72407.1| actin depolymerizing factor 1 [Arabidopsis thaliana] gi|7630029|emb|CAB88325.1| actin depolymerizing factor 1 (ADF1) [Arabidopsis thaliana] gi|14334962|gb|AAK59658.1| putative actin depolymerizing factor ADF1 [Arabidopsis thaliana] gi|17065584|gb|AAL33770.1| putative actin depolymerizing factor 1 [Arabidopsis thaliana] gi|21553985|gb|AAM63066.1| actin-depolymerizing factor ADF-1 (AtADF1) [Arabidopsis thaliana] gi|195604826|gb|ACG24243.1| hypothetical protein [Zea mays] gi|332644579|gb|AEE78100.1| actin depolymerizing factor 1 [Arabidopsis thaliana] Length = 139 Score = 58.5 bits (140), Expect = 1e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 406 SSKDRFKRELDRIQVELQATDPNEMDIEVIRSR 504 SSKDRFKRELD IQVELQATDP EMD++V RSR Sbjct: 105 SSKDRFKRELDGIQVELQATDPTEMDLDVFRSR 137 >ref|XP_002877449.1| hypothetical protein ARALYDRAFT_484981 [Arabidopsis lyrata subsp. lyrata] gi|297323287|gb|EFH53708.1| hypothetical protein ARALYDRAFT_484981 [Arabidopsis lyrata subsp. lyrata] Length = 128 Score = 58.5 bits (140), Expect = 1e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 406 SSKDRFKRELDRIQVELQATDPNEMDIEVIRSR 504 SSKDRFKRELD IQVELQATDP EMD++V RSR Sbjct: 94 SSKDRFKRELDGIQVELQATDPTEMDLDVFRSR 126