BLASTX nr result
ID: Bupleurum21_contig00019660
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00019660 (429 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004138789.1| PREDICTED: NAC domain-containing protein 8-l... 56 3e-06 ref|XP_003546008.1| PREDICTED: NAC domain-containing protein 8-l... 56 3e-06 ref|XP_003543020.1| PREDICTED: NAC domain-containing protein 8-l... 56 3e-06 ref|XP_003540939.1| PREDICTED: NAC domain-containing protein 8-l... 56 3e-06 ref|XP_003526260.1| PREDICTED: NAC domain-containing protein 8-l... 56 3e-06 >ref|XP_004138789.1| PREDICTED: NAC domain-containing protein 8-like [Cucumis sativus] gi|449490373|ref|XP_004158586.1| PREDICTED: NAC domain-containing protein 8-like [Cucumis sativus] Length = 296 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 303 GGIHNLPGLPAGVKFDPSDQ*LLQHLEAKM 392 GGIH LPGLPAGVKFDP+DQ LLQHLE K+ Sbjct: 39 GGIHTLPGLPAGVKFDPTDQELLQHLEGKV 68 >ref|XP_003546008.1| PREDICTED: NAC domain-containing protein 8-like [Glycine max] Length = 322 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +3 Query: 303 GGIHNLPGLPAGVKFDPSDQ*LLQHLEAKM 392 GGIH+LPGLPAGVKFDP+DQ +L+HLEAK+ Sbjct: 53 GGIHDLPGLPAGVKFDPNDQEILEHLEAKV 82 >ref|XP_003543020.1| PREDICTED: NAC domain-containing protein 8-like isoform 1 [Glycine max] gi|356549278|ref|XP_003543021.1| PREDICTED: NAC domain-containing protein 8-like isoform 2 [Glycine max] Length = 332 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +3 Query: 303 GGIHNLPGLPAGVKFDPSDQ*LLQHLEAKM 392 GGIH+LPGLPAGVKFDP+DQ +L+HLEAK+ Sbjct: 65 GGIHDLPGLPAGVKFDPNDQEILEHLEAKV 94 >ref|XP_003540939.1| PREDICTED: NAC domain-containing protein 8-like [Glycine max] Length = 284 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +3 Query: 303 GGIHNLPGLPAGVKFDPSDQ*LLQHLEAKM 392 GGIH+LPGLPAGVKFDP+DQ +L+HLEAK+ Sbjct: 41 GGIHDLPGLPAGVKFDPTDQEILEHLEAKV 70 >ref|XP_003526260.1| PREDICTED: NAC domain-containing protein 8-like [Glycine max] Length = 285 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +3 Query: 303 GGIHNLPGLPAGVKFDPSDQ*LLQHLEAKM 392 GGIH+LPGLPAGVKFDP+DQ +L+HLEAK+ Sbjct: 41 GGIHDLPGLPAGVKFDPTDQEILEHLEAKV 70