BLASTX nr result
ID: Bupleurum21_contig00019460
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00019460 (290 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003625415.1| WD repeat-containing protein [Medicago trunc... 62 6e-08 ref|XP_002320613.1| predicted protein [Populus trichocarpa] gi|2... 59 5e-07 ref|XP_004152006.1| PREDICTED: WD repeat-containing protein 70-l... 58 9e-07 ref|XP_002526531.1| nucleotide binding protein, putative [Ricinu... 58 9e-07 ref|XP_003554306.1| PREDICTED: WD repeat-containing protein 70-l... 57 1e-06 >ref|XP_003625415.1| WD repeat-containing protein [Medicago truncatula] gi|355500430|gb|AES81633.1| WD repeat-containing protein [Medicago truncatula] Length = 611 Score = 61.6 bits (148), Expect = 6e-08 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = +3 Query: 60 DDDGEIYEGIRANFPISFGKKTKSQTPLEAIHKSTIR 170 +D GEIY+G+RA FP+SFGK++KSQTPLE IHK+T R Sbjct: 2 EDSGEIYDGVRAEFPLSFGKQSKSQTPLETIHKATRR 38 >ref|XP_002320613.1| predicted protein [Populus trichocarpa] gi|222861386|gb|EEE98928.1| predicted protein [Populus trichocarpa] Length = 647 Score = 58.5 bits (140), Expect = 5e-07 Identities = 23/38 (60%), Positives = 34/38 (89%) Frame = +3 Query: 57 DDDDGEIYEGIRANFPISFGKKTKSQTPLEAIHKSTIR 170 ++++ EIY+G+RA FP++FGK++KSQTPLE IH +TIR Sbjct: 2 EEEEAEIYDGVRAQFPLTFGKQSKSQTPLEQIHNTTIR 39 >ref|XP_004152006.1| PREDICTED: WD repeat-containing protein 70-like [Cucumis sativus] gi|449509056|ref|XP_004163480.1| PREDICTED: WD repeat-containing protein 70-like [Cucumis sativus] Length = 646 Score = 57.8 bits (138), Expect = 9e-07 Identities = 24/37 (64%), Positives = 33/37 (89%) Frame = +3 Query: 60 DDDGEIYEGIRANFPISFGKKTKSQTPLEAIHKSTIR 170 +D+ EIY+GIRA FP++FGK++K+QTPLEAIH +T R Sbjct: 2 EDEAEIYDGIRAQFPLTFGKQSKAQTPLEAIHNTTRR 38 >ref|XP_002526531.1| nucleotide binding protein, putative [Ricinus communis] gi|223534092|gb|EEF35809.1| nucleotide binding protein, putative [Ricinus communis] Length = 658 Score = 57.8 bits (138), Expect = 9e-07 Identities = 24/37 (64%), Positives = 33/37 (89%) Frame = +3 Query: 60 DDDGEIYEGIRANFPISFGKKTKSQTPLEAIHKSTIR 170 +D+ +IY+GIRA+FP++FGK++KSQTPLE IH ST R Sbjct: 14 EDEADIYDGIRAHFPLTFGKQSKSQTPLEVIHNSTRR 50 >ref|XP_003554306.1| PREDICTED: WD repeat-containing protein 70-like [Glycine max] Length = 614 Score = 57.4 bits (137), Expect = 1e-06 Identities = 23/37 (62%), Positives = 33/37 (89%) Frame = +3 Query: 60 DDDGEIYEGIRANFPISFGKKTKSQTPLEAIHKSTIR 170 +++G+IY+G+RA FP+SFGK++K QTPLEAIH +T R Sbjct: 2 EEEGDIYDGVRAQFPLSFGKQSKPQTPLEAIHNATRR 38