BLASTX nr result
ID: Bupleurum21_contig00018962
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00018962 (322 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002864249.1| predicted protein [Arabidopsis lyrata subsp.... 83 3e-14 ref|XP_002515673.1| oligopeptide transporter, putative [Ricinus ... 82 4e-14 ref|NP_200167.2| metal-nicotianamine transporter YSL3 [Arabidops... 80 1e-13 emb|CBI23058.3| unnamed protein product [Vitis vinifera] 80 1e-13 ref|XP_002274166.1| PREDICTED: metal-nicotianamine transporter Y... 80 1e-13 >ref|XP_002864249.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297310084|gb|EFH40508.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 675 Score = 82.8 bits (203), Expect = 3e-14 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = +3 Query: 3 AGLMVPAVASGLICGDGLWILPSSILALARINPPICMNFLPTQLS 137 AGLMVPAVASGLICGDGLWILPSS+LALA + PPICMNF+P++ S Sbjct: 630 AGLMVPAVASGLICGDGLWILPSSVLALAGVKPPICMNFMPSKYS 674 >ref|XP_002515673.1| oligopeptide transporter, putative [Ricinus communis] gi|223545216|gb|EEF46725.1| oligopeptide transporter, putative [Ricinus communis] Length = 671 Score = 82.4 bits (202), Expect = 4e-14 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = +3 Query: 3 AGLMVPAVASGLICGDGLWILPSSILALARINPPICMNFLPTQ 131 AGLM+PAVASGLICGDGLWILPSSILALA+I+PPICMNFL T+ Sbjct: 629 AGLMLPAVASGLICGDGLWILPSSILALAKIHPPICMNFLATK 671 >ref|NP_200167.2| metal-nicotianamine transporter YSL3 [Arabidopsis thaliana] gi|334188369|ref|NP_001190532.1| metal-nicotianamine transporter YSL3 [Arabidopsis thaliana] gi|122197349|sp|Q2EF88.1|YSL3_ARATH RecName: Full=Metal-nicotianamine transporter YSL3; AltName: Full=Protein YELLOW STRIPE LIKE 3; Short=AtYSL3 gi|88043720|gb|ABD38920.1| metal-nicotianamine transporter YSL3 [Arabidopsis thaliana] gi|332008992|gb|AED96375.1| metal-nicotianamine transporter YSL3 [Arabidopsis thaliana] gi|332008993|gb|AED96376.1| metal-nicotianamine transporter YSL3 [Arabidopsis thaliana] Length = 675 Score = 80.5 bits (197), Expect = 1e-13 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = +3 Query: 3 AGLMVPAVASGLICGDGLWILPSSILALARINPPICMNFLPTQLS 137 AGLMVPAVASGLICGDGLWILPSS+LALA + PPICM F+P++ S Sbjct: 630 AGLMVPAVASGLICGDGLWILPSSVLALAGVRPPICMGFMPSKYS 674 >emb|CBI23058.3| unnamed protein product [Vitis vinifera] Length = 649 Score = 80.5 bits (197), Expect = 1e-13 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +3 Query: 3 AGLMVPAVASGLICGDGLWILPSSILALARINPPICMNFLPT 128 A LMVPAVASGLICGDGLWILPSS+LALA+INPPICM+FL T Sbjct: 608 ASLMVPAVASGLICGDGLWILPSSVLALAKINPPICMSFLAT 649 >ref|XP_002274166.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Vitis vinifera] Length = 665 Score = 80.5 bits (197), Expect = 1e-13 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +3 Query: 3 AGLMVPAVASGLICGDGLWILPSSILALARINPPICMNFLPT 128 A LMVPAVASGLICGDGLWILPSS+LALA+INPPICM+FL T Sbjct: 624 ASLMVPAVASGLICGDGLWILPSSVLALAKINPPICMSFLAT 665