BLASTX nr result
ID: Bupleurum21_contig00018539
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00018539 (301 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268521.1| PREDICTED: uncharacterized protein LOC100256... 62 6e-08 ref|XP_002513115.1| conserved hypothetical protein [Ricinus comm... 60 1e-07 ref|NP_194884.1| high chlorophyll fluorescence 153 protein [Arab... 60 2e-07 ref|XP_002862560.1| hypothetical protein ARALYDRAFT_497397 [Arab... 60 2e-07 ref|XP_002297772.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 >ref|XP_002268521.1| PREDICTED: uncharacterized protein LOC100256905 [Vitis vinifera] Length = 133 Score = 61.6 bits (148), Expect = 6e-08 Identities = 26/40 (65%), Positives = 36/40 (90%) Frame = -1 Query: 301 YIFAFVFPLSLLVATVFTSIRIADKLDEDYLQELAVNQAI 182 Y+FAFVFPLSLL T+FTS+R+ DKL+ ++L+ELAVN+A+ Sbjct: 63 YVFAFVFPLSLLAVTIFTSLRVDDKLEREFLEELAVNEAM 102 >ref|XP_002513115.1| conserved hypothetical protein [Ricinus communis] gi|223548126|gb|EEF49618.1| conserved hypothetical protein [Ricinus communis] Length = 93 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -1 Query: 301 YIFAFVFPLSLLVATVFTSIRIADKLDEDYLQELAV 194 Y+FAFVFPLSLL+ T+ TSIRIADKLD DYL+E+ V Sbjct: 58 YVFAFVFPLSLLIGTIITSIRIADKLDRDYLEEVRV 93 >ref|NP_194884.1| high chlorophyll fluorescence 153 protein [Arabidopsis thaliana] gi|11692862|gb|AAG40034.1|AF324683_1 AT4g31560 [Arabidopsis thaliana] gi|11908100|gb|AAG41479.1|AF326897_1 unknown protein [Arabidopsis thaliana] gi|12642912|gb|AAK00398.1|AF339716_1 unknown protein [Arabidopsis thaliana] gi|13926337|gb|AAK49632.1|AF372916_1 AT4g31560/F3L17_130 [Arabidopsis thaliana] gi|5262767|emb|CAB45915.1| putative protein [Arabidopsis thaliana] gi|7270059|emb|CAB79874.1| putative protein [Arabidopsis thaliana] gi|21592375|gb|AAM64326.1| unknown [Arabidopsis thaliana] gi|27363346|gb|AAO11592.1| At4g31560/F3L17_130 [Arabidopsis thaliana] gi|332660529|gb|AEE85929.1| high chlorophyll fluorescence 153 protein [Arabidopsis thaliana] Length = 137 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/40 (65%), Positives = 35/40 (87%) Frame = -1 Query: 301 YIFAFVFPLSLLVATVFTSIRIADKLDEDYLQELAVNQAI 182 Y+ AF P +L+ ATVFTSI+IADKLDED+L+++A+NQAI Sbjct: 63 YLLAFAIPATLIAATVFTSIKIADKLDEDFLEDIALNQAI 102 >ref|XP_002862560.1| hypothetical protein ARALYDRAFT_497397 [Arabidopsis lyrata subsp. lyrata] gi|297308158|gb|EFH38818.1| hypothetical protein ARALYDRAFT_497397 [Arabidopsis lyrata subsp. lyrata] Length = 137 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/40 (65%), Positives = 35/40 (87%) Frame = -1 Query: 301 YIFAFVFPLSLLVATVFTSIRIADKLDEDYLQELAVNQAI 182 Y+ AF P +L+ ATVFTSI+IADKLDED+L+++A+NQAI Sbjct: 63 YLLAFAIPATLIAATVFTSIKIADKLDEDFLEDIALNQAI 102 >ref|XP_002297772.1| predicted protein [Populus trichocarpa] gi|222845030|gb|EEE82577.1| predicted protein [Populus trichocarpa] Length = 162 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -1 Query: 301 YIFAFVFPLSLLVATVFTSIRIADKLDEDYLQE 203 Y+ AF+ PLSLL AT+FTSIRIADKLD+DYL+E Sbjct: 58 YVLAFLLPLSLLAATIFTSIRIADKLDQDYLEE 90